NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|3769612|gb|AAC80527|]
View 

cyclin E2 [Mus musculus]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CYCLIN cd00043
Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. ...
141-231 3.22e-22

Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.


:

Pssm-ID: 238003  Cd Length: 88  Bit Score: 89.61  E-value: 3.22e-22
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3769612  141 MRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFmLTQKDVNKNMLQLIGITSLFIASKLEEIYaPKLQEFAYVTDGAcSE 220
Cdd:cd00043   1 MRPTPLDFLRRVAKALGLSPETLTLAVNLLDRF-LLDYSVLGRSPSLVAAAALYLAAKVEEIP-PWLKDLVHVTGYA-TE 77
                        90
                ....*....|.
gi 3769612  221 VDILKMELNIL 231
Cdd:cd00043  78 EEILRMEKLLL 88
Cyclin_C pfam02984
Cyclin, C-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human CCNO is a ...
241-361 8.85e-10

Cyclin, C-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human CCNO is a Uracil-DNA glycosylase that is related to other cyclins. Cyclins contain two domains of similar all-alpha fold, of which this family corresponds with the C-terminal domain.


:

Pssm-ID: 251658  Cd Length: 118  Bit Score: 55.72  E-value: 8.85e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3769612    241 VTVISWLNLFLQVDAVkDVPKVLLPQYsqetfiqiaqLLDLCILAIDSLEFQYRILAAAALCHFTSI--------EVVKK 312
Cdd:pfam02984   1 PTPLSFLRRFSKAADV-DKETETLAKY----------LLELSLLDYDFLKYPPSLIAAAAVYLARKTlnpsppwtETLEH 69
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 3769612    313 ASGLEWDDISECVDWMvpFVSVVKSVSPVKLKTFKKIPMEDRHNIQTHT 361
Cdd:pfam02984  70 YTGYSEEDLKPCVKLL--LELLLKAPESKLQAVRKKYSSSKFGSVSTLP 116
 
Name Accession Description Interval E-value
CYCLIN cd00043
Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. ...
141-231 3.22e-22

Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.


Pssm-ID: 238003  Cd Length: 88  Bit Score: 89.61  E-value: 3.22e-22
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3769612  141 MRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFmLTQKDVNKNMLQLIGITSLFIASKLEEIYaPKLQEFAYVTDGAcSE 220
Cdd:cd00043   1 MRPTPLDFLRRVAKALGLSPETLTLAVNLLDRF-LLDYSVLGRSPSLVAAAALYLAAKVEEIP-PWLKDLVHVTGYA-TE 77
                        90
                ....*....|.
gi 3769612  221 VDILKMELNIL 231
Cdd:cd00043  78 EEILRMEKLLL 88
Cyclin_N pfam00134
Cyclin, N-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human cyclin-O is ...
112-239 8.43e-53

Cyclin, N-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human cyclin-O is a Uracil-DNA glycosylase that is related to other cyclins. Cyclins contain two domains of similar all-alpha fold, of which this family corresponds with the N-terminal domain.


Pssm-ID: 249617  Cd Length: 127  Bit Score: 173.88  E-value: 8.43e-53
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3769612    112 EVWQNMLQKENRYVHDKHFQVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKdVNKNMLQLIGIT 191
Cdd:pfam00134   1 DIYAYLRELEEEFRPPPDYLDQQPDINPKMRAILIDWLVEVHEEFKLLPETLYLAVNYLDRFLSKQP-VPRTKLQLVGVT 79
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 3769612    192 SLFIASKLEEIYAPKLQEFAYVTDGACSEVDILKMELNILKALKWELC 239
Cdd:pfam00134  80 CLLIAAKYEEIYPPSVEDFVYITDNAYTKEEILRMELLILSTLNWDLS 127
CYCLIN smart00385
domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and ...
147-232 4.80e-18

domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.


Pssm-ID: 214641  Cd Length: 83  Bit Score: 78.40  E-value: 4.80e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3769612     147 DWLLEVCEVYTLHRETFYLAQDFFDRFmLTQKDVNKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDgaCSEVDILKM 226
Cdd:smart00385   1 DFLRRVCKALNLDPETLNLAVNLLDRF-LSDYKFLKYSPSLIAAAALYLASKTEETPPWTKELVHYTGY--FTEEEILRM 77

                   ....*.
gi 3769612     227 ELNILK 232
Cdd:smart00385  78 ERLLLE 83
Cyclin_C pfam02984
Cyclin, C-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human CCNO is a ...
241-361 8.85e-10

Cyclin, C-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human CCNO is a Uracil-DNA glycosylase that is related to other cyclins. Cyclins contain two domains of similar all-alpha fold, of which this family corresponds with the C-terminal domain.


Pssm-ID: 251658  Cd Length: 118  Bit Score: 55.72  E-value: 8.85e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3769612    241 VTVISWLNLFLQVDAVkDVPKVLLPQYsqetfiqiaqLLDLCILAIDSLEFQYRILAAAALCHFTSI--------EVVKK 312
Cdd:pfam02984   1 PTPLSFLRRFSKAADV-DKETETLAKY----------LLELSLLDYDFLKYPPSLIAAAAVYLARKTlnpsppwtETLEH 69
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 3769612    313 ASGLEWDDISECVDWMvpFVSVVKSVSPVKLKTFKKIPMEDRHNIQTHT 361
Cdd:pfam02984  70 YTGYSEEDLKPCVKLL--LELLLKAPESKLQAVRKKYSSSKFGSVSTLP 116
COG5024 COG5024
Cyclin [Cell division and chromosome partitioning]
117-309 2.52e-26

Cyclin [Cell division and chromosome partitioning]


Pssm-ID: 227357 [Multi-domain]  Cd Length: 440  Bit Score: 108.32  E-value: 2.52e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3769612  117 MLQKENRYVHDKHFQVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFmLTQKDVNKNMLQLIGITSLFIA 196
Cdd:COG5024 188 LLKLELIDLPNPNYLIKQSLYEWSMRSILVDWLVEVHGKFGLLPETLFLAINIIDRF-LSSRVVSLEKYQLVGISALFIA 266
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3769612  197 SKLEEIYAPKLQEFAYVTDGACSEVDILKMELNILKALKWELCPVTVISWLNLFLQVDavkdvpkvllpQYSQETFIQIA 276
Cdd:COG5024 267 SKYEEVNCPSIKDLVYATDGAFTRDDIIRAERYMLEVLDFNISWPSPMSFLRRISKAS-----------DYDIFSRTPAK 335
                       170       180       190
                ....*....|....*....|....*....|...
gi 3769612  277 QLLDLCILAIDSLEFQYRILAAAAlcHFTSIEV 309
Cdd:COG5024 336 FSSEISPVDYKFIQISPSWCAAAA--MYLSRKI 366
 
Name Accession Description Interval E-value
CYCLIN cd00043
Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. ...
141-231 3.22e-22

Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.


Pssm-ID: 238003  Cd Length: 88  Bit Score: 89.61  E-value: 3.22e-22
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3769612  141 MRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFmLTQKDVNKNMLQLIGITSLFIASKLEEIYaPKLQEFAYVTDGAcSE 220
Cdd:cd00043   1 MRPTPLDFLRRVAKALGLSPETLTLAVNLLDRF-LLDYSVLGRSPSLVAAAALYLAAKVEEIP-PWLKDLVHVTGYA-TE 77
                        90
                ....*....|.
gi 3769612  221 VDILKMELNIL 231
Cdd:cd00043  78 EEILRMEKLLL 88
Cyclin_N pfam00134
Cyclin, N-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human cyclin-O is ...
112-239 8.43e-53

Cyclin, N-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human cyclin-O is a Uracil-DNA glycosylase that is related to other cyclins. Cyclins contain two domains of similar all-alpha fold, of which this family corresponds with the N-terminal domain.


Pssm-ID: 249617  Cd Length: 127  Bit Score: 173.88  E-value: 8.43e-53
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3769612    112 EVWQNMLQKENRYVHDKHFQVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKdVNKNMLQLIGIT 191
Cdd:pfam00134   1 DIYAYLRELEEEFRPPPDYLDQQPDINPKMRAILIDWLVEVHEEFKLLPETLYLAVNYLDRFLSKQP-VPRTKLQLVGVT 79
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 3769612    192 SLFIASKLEEIYAPKLQEFAYVTDGACSEVDILKMELNILKALKWELC 239
Cdd:pfam00134  80 CLLIAAKYEEIYPPSVEDFVYITDNAYTKEEILRMELLILSTLNWDLS 127
CYCLIN smart00385
domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and ...
147-232 4.80e-18

domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.


Pssm-ID: 214641  Cd Length: 83  Bit Score: 78.40  E-value: 4.80e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3769612     147 DWLLEVCEVYTLHRETFYLAQDFFDRFmLTQKDVNKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDgaCSEVDILKM 226
Cdd:smart00385   1 DFLRRVCKALNLDPETLNLAVNLLDRF-LSDYKFLKYSPSLIAAAALYLASKTEETPPWTKELVHYTGY--FTEEEILRM 77

                   ....*.
gi 3769612     227 ELNILK 232
Cdd:smart00385  78 ERLLLE 83
Cyclin_C pfam02984
Cyclin, C-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human CCNO is a ...
241-361 8.85e-10

Cyclin, C-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human CCNO is a Uracil-DNA glycosylase that is related to other cyclins. Cyclins contain two domains of similar all-alpha fold, of which this family corresponds with the C-terminal domain.


Pssm-ID: 251658  Cd Length: 118  Bit Score: 55.72  E-value: 8.85e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3769612    241 VTVISWLNLFLQVDAVkDVPKVLLPQYsqetfiqiaqLLDLCILAIDSLEFQYRILAAAALCHFTSI--------EVVKK 312
Cdd:pfam02984   1 PTPLSFLRRFSKAADV-DKETETLAKY----------LLELSLLDYDFLKYPPSLIAAAAVYLARKTlnpsppwtETLEH 69
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 3769612    313 ASGLEWDDISECVDWMvpFVSVVKSVSPVKLKTFKKIPMEDRHNIQTHT 361
Cdd:pfam02984  70 YTGYSEEDLKPCVKLL--LELLLKAPESKLQAVRKKYSSSKFGSVSTLP 116
COG5024 COG5024
Cyclin [Cell division and chromosome partitioning]
117-309 2.52e-26

Cyclin [Cell division and chromosome partitioning]


Pssm-ID: 227357 [Multi-domain]  Cd Length: 440  Bit Score: 108.32  E-value: 2.52e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3769612  117 MLQKENRYVHDKHFQVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFmLTQKDVNKNMLQLIGITSLFIA 196
Cdd:COG5024 188 LLKLELIDLPNPNYLIKQSLYEWSMRSILVDWLVEVHGKFGLLPETLFLAINIIDRF-LSSRVVSLEKYQLVGISALFIA 266
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3769612  197 SKLEEIYAPKLQEFAYVTDGACSEVDILKMELNILKALKWELCPVTVISWLNLFLQVDavkdvpkvllpQYSQETFIQIA 276
Cdd:COG5024 267 SKYEEVNCPSIKDLVYATDGAFTRDDIIRAERYMLEVLDFNISWPSPMSFLRRISKAS-----------DYDIFSRTPAK 335
                       170       180       190
                ....*....|....*....|....*....|...
gi 3769612  277 QLLDLCILAIDSLEFQYRILAAAAlcHFTSIEV 309
Cdd:COG5024 336 FSSEISPVDYKFIQISPSWCAAAA--MYLSRKI 366
CCL1 COG5333
Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision ...
133-238 8.91e-03

Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]


Pssm-ID: 227640 [Multi-domain]  Cd Length: 297  Bit Score: 36.25  E-value: 8.91e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3769612  133 LHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLtQKDVNKNMLQLIGITSLFIASKLEEiyapKLQEFay 212
Cdd:COG5333  36 LTLEKELNLVIYYLKLIMDLCTRLNLPQTVLATAILFFSRFYL-KNSVEEISLYSVVTTCVYLACKVED----TPRDI-- 108
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 3769612  213 VTDGAC-----SEVD------ILKMELNILKALKWEL 238
Cdd:COG5333 109 SIESFEardlwSEEPkssrerILEYEFELLEALDFDL 145
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH