NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|408536135|pdb|4HDT|A]
View 

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ECH_2 pfam16113
Enoyl-CoA hydratase/isomerase; This family contains a diverse set of enzymes including: ...
20-338 3.03e-150

Enoyl-CoA hydratase/isomerase; This family contains a diverse set of enzymes including: enoyl-CoA hydratase, napthoate synthase, carnitate racemase, 3-hydroxybutyryl-CoA dehydratase and dodecanoyl-CoA delta-isomerase. This family differs from pfam00378 in the structure of it's C-terminus.


:

Pssm-ID: 292731  Cd Length: 295  Bit Score: 428.38  E-value: 3.03e-150
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         20 GLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIYHSAKA-DGAEARRFWFDEYRLN 98
Cdd:pfam16113   1 GVITLNRPKALNALNLEMVRALLAALKAWEDDPAVKAVVLKGAGERAFCAGGDVRALYEAAKAgDGEAARDFFREEYRLN 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         99 AHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKLGLHAALTGAPFSGA 178
Cdd:pfam16113  81 YLIATYPKPYVALMDGIVMGGGVGLSVHGSHRVVTERTRFAMPETAIGLFPDVGGSYFLSRLPGELGLYLALTGARLNGA 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        179 DAIVMGFADHYVPHDKIDEFtraviadgvdaalaahaqeppasplaEQRSWIDECYTGDTVADIIAALRAH--DAPAAGE 256
Cdd:pfam16113 161 DALAAGLATHYVPSEDLPAL--------------------------EEALAIDRCFSADTVEEIVAALEAEadGDEWAAK 214
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        257 AADLIATRSPIALSVTLESVRRAAKLqSLEDTLRQEYRVSCASLKSHDLVEGIRAQLVDKDRNPKWRPATLAEVTEADVE 336
Cdd:pfam16113 215 TLKTLRKRSPTSLKVTLRQLRRGRKL-SLAECLRMEYRLALRCLRRPDFYEGVRALLIDKDRNPKWSPATLEEVTDEMVD 293

                  ..
4HDT_A        337 AY 338
Cdd:pfam16113 294 AY 295
PRK05617 PRK05617
3-hydroxyisobutyryl-CoA hydrolase; Provisional
8-341 1.78e-178

3-hydroxyisobutyryl-CoA hydrolase; Provisional


:

Pssm-ID: 235533 [Multi-domain]  Cd Length: 342  Bit Score: 501.66  E-value: 1.78e-178
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         8 NEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIYHSAKADGAEA 87
Cdd:PRK05617   2 EDEVLAEVEGGVGVITLNRPKALNALSLEMIRAIDAALDAWEDDDAVAAVVIEGAGERGFCAGGDIRALYEAARAGDPLA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        88 R-RFWFDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKLGL 166
Cdd:PRK05617  82 AdRFFREEYRLNALIARYPKPYIALMDGIVMGGGVGISAHGSHRIVTERTKMAMPETGIGFFPDVGGTYFLSRAPGALGT 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       167 HAALTGAPFSGADAIVMGFADHYVPHDKIDEFTRAVI-------ADGVDAALAAHAQEPPASPLAEQRSWIDECYTGDTV 239
Cdd:PRK05617 162 YLALTGARISAADALYAGLADHFVPSADLPALLDALIslrwdsgADVVDAALAAFATPAPASELAAQRAWIDECFAGDTV 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       240 ADIIAALRAHDAPAAGEAADLIATRSPIALSVTLESVRRAAKLqSLEDTLRQEYRVSCASLKSHDLVEGIRAQLVDKDRN 319
Cdd:PRK05617 242 EDIIAALEADGGEFAAKTADTLRSRSPTSLKVTLEQLRRARGL-TLEECLRRELRLALAMLRSPDFVEGVRAVLIDKDRN 320
                        330       340
                 ....*....|....*....|..
4HDT_A       320 PKWRPATLAEVTEADVEAYFAP 341
Cdd:PRK05617 321 PKWSPATLEDVTPEDVEAFFAP 342
 
Name Accession Description Interval E-value
ECH_2 pfam16113
Enoyl-CoA hydratase/isomerase; This family contains a diverse set of enzymes including: ...
20-338 3.03e-150

Enoyl-CoA hydratase/isomerase; This family contains a diverse set of enzymes including: enoyl-CoA hydratase, napthoate synthase, carnitate racemase, 3-hydroxybutyryl-CoA dehydratase and dodecanoyl-CoA delta-isomerase. This family differs from pfam00378 in the structure of it's C-terminus.


Pssm-ID: 292731  Cd Length: 295  Bit Score: 428.38  E-value: 3.03e-150
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         20 GLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIYHSAKA-DGAEARRFWFDEYRLN 98
Cdd:pfam16113   1 GVITLNRPKALNALNLEMVRALLAALKAWEDDPAVKAVVLKGAGERAFCAGGDVRALYEAAKAgDGEAARDFFREEYRLN 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         99 AHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKLGLHAALTGAPFSGA 178
Cdd:pfam16113  81 YLIATYPKPYVALMDGIVMGGGVGLSVHGSHRVVTERTRFAMPETAIGLFPDVGGSYFLSRLPGELGLYLALTGARLNGA 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        179 DAIVMGFADHYVPHDKIDEFtraviadgvdaalaahaqeppasplaEQRSWIDECYTGDTVADIIAALRAH--DAPAAGE 256
Cdd:pfam16113 161 DALAAGLATHYVPSEDLPAL--------------------------EEALAIDRCFSADTVEEIVAALEAEadGDEWAAK 214
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        257 AADLIATRSPIALSVTLESVRRAAKLqSLEDTLRQEYRVSCASLKSHDLVEGIRAQLVDKDRNPKWRPATLAEVTEADVE 336
Cdd:pfam16113 215 TLKTLRKRSPTSLKVTLRQLRRGRKL-SLAECLRMEYRLALRCLRRPDFYEGVRALLIDKDRNPKWSPATLEEVTDEMVD 293

                  ..
4HDT_A        337 AY 338
Cdd:pfam16113 294 AY 295
PLN02851 PLN02851
3-hydroxyisobutyryl-CoA hydrolase-like protein
6-346 5.23e-68

3-hydroxyisobutyryl-CoA hydrolase-like protein


Pssm-ID: 178443  Cd Length: 407  Bit Score: 221.39  E-value: 5.23e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         6 AKNED----VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHSA- 80
Cdd:PLN02851  35 AANDDlqdqVLVEGRAKSRAAILNRPSSLNALTIPMVARLKRLYESWEENPDIGFVLMKGSG-RAFCSGADVVSLYHLIn 113
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        81 KADGAEARRFWFDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRA 160
Cdd:PLN02851 114 EGNVEECKLFFENLYKFVYLQGTYLKPNVAIMDGITMGCGAGISIPGMFRVVTDKTVFAHPEVQMGFHPDAGASYYLSRL 193
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       161 PGKLGLHAALTGAPFSGADAIVMGFADHYVPHDK---IDEFTRAVIADG---VDAALAAHAQ--EPPASPLAEQRSWIDE 232
Cdd:PLN02851 194 PGYLGEYLALTGQKLNGVEMIACGLATHYCLNARlplIEERLGKLLTDDpavIEDSLAQYGDlvYPDKSSVLHKIETIDK 273
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       233 CYTGDTVADIIAALRAHDAPAAGE----AADLIATRSPIALSVTLESVRRaAKLQSLEDTLRQEYRVSCASLK---SHDL 305
Cdd:PLN02851 274 CFGHDTVEEIIEALENEAASSYDEwckkALKKIKEASPLSLKVTLQSIRE-GRFQTLDQCLAREYRISLCGVSkwvSGDF 352
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....
4HDT_A       306 VEGIRAQLVDKDRNPKWRPATLAEVTEADVEAYFAPVD---PEL 346
Cdd:PLN02851 353 CEGVRARLVDKDFAPKWDPPSLGEVSKDMVDCYFTPLDeseSEL 396
CaiD COG1024
Enoyl-CoA hydratase/carnithine racemase [Lipid transport and metabolism];
5-322 1.04e-42

Enoyl-CoA hydratase/carnithine racemase [Lipid transport and metabolism];


Pssm-ID: 223955  Cd Length: 257  Bit Score: 150.24  E-value: 1.04e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        5 TAKNEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYhsAKADG 84
Cdd:COG1024   1 MTTYETILVEREDGIAVITLNRPEKLNALNLEMLDELAEALDEAEADPDVRVVVLTGAG-KAFSAGADLKELL--SPEDG 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       85 AEARRFWFDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKL 164
Cdd:COG1024  78 NAAENLMQPGQDLLRALADLPKPVIAAVNGYALGGGLELALACDIRIAAEDAKFGLPEVNLGLLPGDGGTQRLPRLLGRG 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A      165 G-LHAALTGAPFSGADAIVMGFADHYVPHdkideftraviadgVDAALAahaqeppasplaeqrswidecytgdtvadii 243
Cdd:COG1024 158 RaKELLLTGEPISAAEALELGLVDEVVPD--------------AEELLE------------------------------- 192
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
4HDT_A      244 aalrahdapAAGEAADLIAtRSPIALSVTLESVRRAAKLqSLEDTLRQEYRVSCASLKSHDLVEGIRAQLvdkDRNPKW 322
Cdd:COG1024 193 ---------RALELARRLA-APPLALAATKRLVRAALEA-DLAEALEAEALAFARLFSSEDFREGVRAFL---ERKPVF 257
crotonase-like cd06558
Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse ...
11-205 5.35e-41

Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse set of enzymes including enoyl-CoA hydratase, napthoate synthase, methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA dehydratase, and dienoyl-CoA isomerase. Many of these play important roles in fatty acid metabolism. In addition to a conserved structural core and the formation of trimers (or dimers of trimers), a common feature in this superfamily is the stabilization of an enolate anion intermediate derived from an acyl-CoA substrate. This is accomplished by two conserved backbone NH groups in active sites that form an oxyanion hole.


Pssm-ID: 119339  Cd Length: 195  Bit Score: 143.86  E-value: 5.35e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       11 VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIyHSAKADGAEARRF 90
Cdd:cd06558   1 VLVERDGGVATITLNRPEKRNALSLEMLDELAAALDEAEADPDVRVVVLTGAG-KAFCAGADLKEL-AALSDAGEEARAF 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       91 WFDEYRLNAHIGRYPKPYVSIM---------------DGivmgggvgvgahgnvRVVTDTTKMAMPEVGIGFIPDVGGTY 155
Cdd:cd06558  79 IRELQELLRALLRLPKPVIAAVngaalggglelalacDI---------------RIAAEDAKFGLPEVKLGLVPGGGGTQ 143
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|.
4HDT_A      156 LLSRAPG-KLGLHAALTGAPFSGADAIVMGFADHYVPHDKIDEFTRAVIAD 205
Cdd:cd06558 144 RLPRLVGpARARELLLTGRRISAEEALELGLVDEVVPDEELLAAALELARR 194
PaaB1 TIGR02280
phenylacetate degradation probable enoyl-CoA hydratase paaB; This family of proteins are found ...
11-224 7.10e-18

phenylacetate degradation probable enoyl-CoA hydratase paaB; This family of proteins are found within apparent operons for the degradation of phenylacetic acid. These proteins contain the enoyl-CoA hydratase domain as detected by pfam00378. This activity is consistent with current hypotheses for the degradation pathway, which involve the ligation of phenylacetate with coenzyme A (paaF), hydroxylation (paaGHIJK), ring-opening (paaN) and degradation of the resulting fatty acid-like compound to a Krebs cycle intermediate (paaABCDE).


Pssm-ID: 274065  Cd Length: 257  Bit Score: 80.67  E-value: 7.10e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         11 VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHSAKAD---GAEA 87
Cdd:TIGR02280   1 ILSHLEKGVATLTLNRPDKLNSFNAEMHAELAEALKRVERDDTARALLLTGAG-RGFCAGQDLSDRNVTPGPApdlGMTV 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         88 RRFWFDEYRLnahIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGK---L 164
Cdd:TIGR02280  80 ERFYNPLVRR---LAALPKPVICAVNGVAAGAGANLALAGDIVIAARSAKFIQAFSKLGLIPDSGGTWLLPRLVGRaraM 156
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        165 GLhaALTGAPFSGADAIVMGFADHYVpHDkideftrAVIADGVDaALAAHAQEPPASPLA 224
Cdd:TIGR02280 157 GL--ALLGNKLSAEQAHEWGLIWQVV-DD-------ATLMDEAQ-ALARHLATQPTRGLG 205
PRK05617 PRK05617
3-hydroxyisobutyryl-CoA hydrolase; Provisional
8-341 1.78e-178

3-hydroxyisobutyryl-CoA hydrolase; Provisional


Pssm-ID: 235533 [Multi-domain]  Cd Length: 342  Bit Score: 501.66  E-value: 1.78e-178
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         8 NEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIYHSAKADGAEA 87
Cdd:PRK05617   2 EDEVLAEVEGGVGVITLNRPKALNALSLEMIRAIDAALDAWEDDDAVAAVVIEGAGERGFCAGGDIRALYEAARAGDPLA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        88 R-RFWFDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKLGL 166
Cdd:PRK05617  82 AdRFFREEYRLNALIARYPKPYIALMDGIVMGGGVGISAHGSHRIVTERTKMAMPETGIGFFPDVGGTYFLSRAPGALGT 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       167 HAALTGAPFSGADAIVMGFADHYVPHDKIDEFTRAVI-------ADGVDAALAAHAQEPPASPLAEQRSWIDECYTGDTV 239
Cdd:PRK05617 162 YLALTGARISAADALYAGLADHFVPSADLPALLDALIslrwdsgADVVDAALAAFATPAPASELAAQRAWIDECFAGDTV 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       240 ADIIAALRAHDAPAAGEAADLIATRSPIALSVTLESVRRAAKLqSLEDTLRQEYRVSCASLKSHDLVEGIRAQLVDKDRN 319
Cdd:PRK05617 242 EDIIAALEADGGEFAAKTADTLRSRSPTSLKVTLEQLRRARGL-TLEECLRRELRLALAMLRSPDFVEGVRAVLIDKDRN 320
                        330       340
                 ....*....|....*....|..
4HDT_A       320 PKWRPATLAEVTEADVEAYFAP 341
Cdd:PRK05617 321 PKWSPATLEDVTPEDVEAFFAP 342
FadB TIGR02437
fatty oxidation complex, alpha subunit FadB; Members represent alpha subunit of ...
15-286 4.09e-09

fatty oxidation complex, alpha subunit FadB; Members represent alpha subunit of multifunctional enzyme complex of the fatty acid degradation cycle. Activities include: enoyl-CoA hydratase (EC 4.2.1.17), dodecenoyl-CoA delta-isomerase activity (EC 5.3.3.8), 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35), 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3). A representative is E. coli FadB (SP:P21177). This model excludes the FadJ family represented by SP:P77399. [Fatty acid and phospholipid metabolism, Degradation]


Pssm-ID: 131490 [Multi-domain]  Cd Length: 714  Bit Score: 56.76  E-value: 4.09e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         15 VEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTgAGERGLCAGGDVVAIYHSAKADGAEARRFWFDE 94
Cdd:TIGR02437  13 LEDGIAELKFDAPGSVNKFDRATLASLDQALDAIKAQSSLKGVILT-SGKDAFIVGADITEFLGLFALPDAELIQWLLFA 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         95 YRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYllsRAPGKLGLHAAL---- 170
Cdd:TIGR02437  92 NSIFNKLEDLPVPTVAAINGIALGGGCECVLATDFRIADDTAKIGLPETKLGIMPGFGGTV---RLPRVIGADNALewia 168
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        171 TGAPFSGADAIVMGFADHYVPHDKIDEFTRAVIADGVDAALAAHAQ-EPPASPLaeQRSWIDECYTGDTVADIIAALRAH 249
Cdd:TIGR02437 169 SGKENRAEDALKVGAVDAVVTADKLGAAALQLLKDAINGKLDWKAKrQPKLEPL--KLSKIEAMMSFTTAKGMVAQVAGP 246
                         250       260       270
                  ....*....|....*....|....*....|....*..
4HDT_A        250 DAPAageaadliatrsPIALSVTLESVRRAAKLQSLE 286
Cdd:TIGR02437 247 HYPA------------PMTAVKTIEKAARFGRDKALE 271
 
Name Accession Description Interval E-value
ECH_2 pfam16113
Enoyl-CoA hydratase/isomerase; This family contains a diverse set of enzymes including: ...
20-338 3.03e-150

Enoyl-CoA hydratase/isomerase; This family contains a diverse set of enzymes including: enoyl-CoA hydratase, napthoate synthase, carnitate racemase, 3-hydroxybutyryl-CoA dehydratase and dodecanoyl-CoA delta-isomerase. This family differs from pfam00378 in the structure of it's C-terminus.


Pssm-ID: 292731  Cd Length: 295  Bit Score: 428.38  E-value: 3.03e-150
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         20 GLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIYHSAKA-DGAEARRFWFDEYRLN 98
Cdd:pfam16113   1 GVITLNRPKALNALNLEMVRALLAALKAWEDDPAVKAVVLKGAGERAFCAGGDVRALYEAAKAgDGEAARDFFREEYRLN 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         99 AHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKLGLHAALTGAPFSGA 178
Cdd:pfam16113  81 YLIATYPKPYVALMDGIVMGGGVGLSVHGSHRVVTERTRFAMPETAIGLFPDVGGSYFLSRLPGELGLYLALTGARLNGA 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        179 DAIVMGFADHYVPHDKIDEFtraviadgvdaalaahaqeppasplaEQRSWIDECYTGDTVADIIAALRAH--DAPAAGE 256
Cdd:pfam16113 161 DALAAGLATHYVPSEDLPAL--------------------------EEALAIDRCFSADTVEEIVAALEAEadGDEWAAK 214
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        257 AADLIATRSPIALSVTLESVRRAAKLqSLEDTLRQEYRVSCASLKSHDLVEGIRAQLVDKDRNPKWRPATLAEVTEADVE 336
Cdd:pfam16113 215 TLKTLRKRSPTSLKVTLRQLRRGRKL-SLAECLRMEYRLALRCLRRPDFYEGVRALLIDKDRNPKWSPATLEEVTDEMVD 293

                  ..
4HDT_A        337 AY 338
Cdd:pfam16113 294 AY 295
PLN02851 PLN02851
3-hydroxyisobutyryl-CoA hydrolase-like protein
6-346 5.23e-68

3-hydroxyisobutyryl-CoA hydrolase-like protein


Pssm-ID: 178443  Cd Length: 407  Bit Score: 221.39  E-value: 5.23e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         6 AKNED----VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHSA- 80
Cdd:PLN02851  35 AANDDlqdqVLVEGRAKSRAAILNRPSSLNALTIPMVARLKRLYESWEENPDIGFVLMKGSG-RAFCSGADVVSLYHLIn 113
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        81 KADGAEARRFWFDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRA 160
Cdd:PLN02851 114 EGNVEECKLFFENLYKFVYLQGTYLKPNVAIMDGITMGCGAGISIPGMFRVVTDKTVFAHPEVQMGFHPDAGASYYLSRL 193
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       161 PGKLGLHAALTGAPFSGADAIVMGFADHYVPHDK---IDEFTRAVIADG---VDAALAAHAQ--EPPASPLAEQRSWIDE 232
Cdd:PLN02851 194 PGYLGEYLALTGQKLNGVEMIACGLATHYCLNARlplIEERLGKLLTDDpavIEDSLAQYGDlvYPDKSSVLHKIETIDK 273
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       233 CYTGDTVADIIAALRAHDAPAAGE----AADLIATRSPIALSVTLESVRRaAKLQSLEDTLRQEYRVSCASLK---SHDL 305
Cdd:PLN02851 274 CFGHDTVEEIIEALENEAASSYDEwckkALKKIKEASPLSLKVTLQSIRE-GRFQTLDQCLAREYRISLCGVSkwvSGDF 352
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....
4HDT_A       306 VEGIRAQLVDKDRNPKWRPATLAEVTEADVEAYFAPVD---PEL 346
Cdd:PLN02851 353 CEGVRARLVDKDFAPKWDPPSLGEVSKDMVDCYFTPLDeseSEL 396
PLN02988 PLN02988
3-hydroxyisobutyryl-CoA hydrolase
6-349 9.95e-63

3-hydroxyisobutyryl-CoA hydrolase


Pssm-ID: 178568  Cd Length: 381  Bit Score: 206.88  E-value: 9.95e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         6 AKNEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHS-AKADG 84
Cdd:PLN02988   6 ASQSQVLVEEKSSVRILTLNRPKQLNALSFHMISRLLQLFLAFEEDPSVKLVILKGHG-RAFCAGGDVAAVVRDiEQGNW 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        85 AEARRFWFDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKL 164
Cdd:PLN02988  85 RLGANFFSDEYMLNYVMATYSKAQVSILNGIVMGGGAGVSVHGRFRIATENTVFAMPETALGLFPDVGASYFLSRLPGFF 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       165 GLHAALTGAPFSGADAIVMGFADHYVPHDKIDEFTRAVIADGVD------AALAAHAQEPPASPLA--EQRSWIDECYTG 236
Cdd:PLN02988 165 GEYVGLTGARLDGAEMLACGLATHFVPSTRLTALEADLCRIGSNdptfasTILDAYTQHPRLKPQSayHRLDVIDRCFSR 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       237 DTVADIIAALrahDAPAAGEAADLIATR-------SPIALSVTLESVRRaAKLQSLEDTLRQEYRVSCASLK---SHDLV 306
Cdd:PLN02988 245 RTVEEIISAL---EREATQEADGWISATiqalkkaSPASLKISLRSIRE-GRLQGVGQCLIREYRMVCHVMKgeiSKDFV 320
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|...
4HDT_A       307 EGIRAQLVDKDRNPKWRPATLAEVTEADVEAYFAPVDPELTFE 349
Cdd:PLN02988 321 EGCRAILVDKDKNPKWEPRRLEDMKDSMVEQYFERVEEEEEWD 363
CaiD COG1024
Enoyl-CoA hydratase/carnithine racemase [Lipid transport and metabolism];
5-322 1.04e-42

Enoyl-CoA hydratase/carnithine racemase [Lipid transport and metabolism];


Pssm-ID: 223955  Cd Length: 257  Bit Score: 150.24  E-value: 1.04e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        5 TAKNEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYhsAKADG 84
Cdd:COG1024   1 MTTYETILVEREDGIAVITLNRPEKLNALNLEMLDELAEALDEAEADPDVRVVVLTGAG-KAFSAGADLKELL--SPEDG 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       85 AEARRFWFDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKL 164
Cdd:COG1024  78 NAAENLMQPGQDLLRALADLPKPVIAAVNGYALGGGLELALACDIRIAAEDAKFGLPEVNLGLLPGDGGTQRLPRLLGRG 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A      165 G-LHAALTGAPFSGADAIVMGFADHYVPHdkideftraviadgVDAALAahaqeppasplaeqrswidecytgdtvadii 243
Cdd:COG1024 158 RaKELLLTGEPISAAEALELGLVDEVVPD--------------AEELLE------------------------------- 192
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
4HDT_A      244 aalrahdapAAGEAADLIAtRSPIALSVTLESVRRAAKLqSLEDTLRQEYRVSCASLKSHDLVEGIRAQLvdkDRNPKW 322
Cdd:COG1024 193 ---------RALELARRLA-APPLALAATKRLVRAALEA-DLAEALEAEALAFARLFSSEDFREGVRAFL---ERKPVF 257
crotonase-like cd06558
Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse ...
11-205 5.35e-41

Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse set of enzymes including enoyl-CoA hydratase, napthoate synthase, methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA dehydratase, and dienoyl-CoA isomerase. Many of these play important roles in fatty acid metabolism. In addition to a conserved structural core and the formation of trimers (or dimers of trimers), a common feature in this superfamily is the stabilization of an enolate anion intermediate derived from an acyl-CoA substrate. This is accomplished by two conserved backbone NH groups in active sites that form an oxyanion hole.


Pssm-ID: 119339  Cd Length: 195  Bit Score: 143.86  E-value: 5.35e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       11 VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIyHSAKADGAEARRF 90
Cdd:cd06558   1 VLVERDGGVATITLNRPEKRNALSLEMLDELAAALDEAEADPDVRVVVLTGAG-KAFCAGADLKEL-AALSDAGEEARAF 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       91 WFDEYRLNAHIGRYPKPYVSIM---------------DGivmgggvgvgahgnvRVVTDTTKMAMPEVGIGFIPDVGGTY 155
Cdd:cd06558  79 IRELQELLRALLRLPKPVIAAVngaalggglelalacDI---------------RIAAEDAKFGLPEVKLGLVPGGGGTQ 143
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|.
4HDT_A      156 LLSRAPG-KLGLHAALTGAPFSGADAIVMGFADHYVPHDKIDEFTRAVIAD 205
Cdd:cd06558 144 RLPRLVGpARARELLLTGRRISAEEALELGLVDEVVPDEELLAAALELARR 194
PRK06688 PRK06688
enoyl-CoA hydratase; Provisional
8-259 3.22e-29

enoyl-CoA hydratase; Provisional


Pssm-ID: 235852  Cd Length: 259  Bit Score: 113.42  E-value: 3.22e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         8 NEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHSAKADGAEA 87
Cdd:PRK06688   4 VTDLLVELEDGVLTITINRPDKKNALTAAMYQALADALEAAATDPAVRVVVLTGAG-RAFSAGGDIKDFPKAPPKPPDEL 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        88 RRFWfdeyRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGK-LGL 166
Cdd:PRK06688  83 APVN----RFLRAIAALPKPVVAAVNGPAVGVGVSLALACDLVYASESAKFSLPFAKLGLCPDAGGSALLPRLIGRaRAA 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       167 HAALTGAPFSGADAIVMGFADHYVPHDKIDEFTRAVIadgvdAALAAHaqepPASPLAEQRSWIDECyTGDTVADIIAAL 246
Cdd:PRK06688 159 EMLLLGEPLSAEEALRIGLVNRVVPAAELDAEADAQA-----AKLAAG----PASALRYTKRAINAA-TLTELEEALARE 228
                        250
                 ....*....|....*...
4HDT_A       247 RAH-----DAPAAGEAAD 259
Cdd:PRK06688 229 AAGfgrllRTPDFREGAT 246
PRK05980 PRK05980
enoyl-CoA hydratase; Provisional
11-212 1.77e-28

enoyl-CoA hydratase; Provisional


Pssm-ID: 180335  Cd Length: 260  Bit Score: 111.39  E-value: 1.77e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        11 VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIYHSAkADGAEA--R 88
Cdd:PRK05980   5 VLIEIRDGIALLTLNRPEKLNALNYALIDRLLARLDAIEVDESVRAVILTGAGDRAFSAGADIHEFSASV-AAGADValR 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        89 RFWFDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPG-KLGLH 167
Cdd:PRK05980  84 DFVRRGQAMTARLEAFPKPVIAAVNGLAFGGGCEITEAVHLAIASERALFAKPEIRLGMPPTFGGTQRLPRLAGrKRALE 163
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
4HDT_A       168 AALTGAPFSGADAIVMGFADHYVPHDKI----DEFTRAVIADGVDAALA 212
Cdd:PRK05980 164 LLLTGDAFSAERALEIGLVNAVVPHEELlpaaRALARRIIRHSPVAVAA 212
ECH_1 pfam00378
Enoyl-CoA hydratase/isomerase; This family contains a diverse set of enzymes including: ...
16-216 4.74e-27

Enoyl-CoA hydratase/isomerase; This family contains a diverse set of enzymes including: enoyl-CoA hydratase, napthoate synthase, carnitate racemase, 3-hydroxybutyryl-CoA dehydratase and dodecanoyl-CoA delta-isomerase.


Pssm-ID: 278790  Cd Length: 251  Bit Score: 107.06  E-value: 4.74e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         16 EGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGaGERGLCAGGDVVAIYHSAKADGAEarrFWFDEY 95
Cdd:pfam00378   3 NAGVAVITLNRPEAVNALSAELITELIQALEKLRTDPSVRAVVLTG-GDKAFCAGADLKEMYGEGPAHQAL---YRENVL 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         96 RLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGK-LGLHAALTGAP 174
Cdd:pfam00378  79 DLWTLLYTCPKPVIAAVNGYAIGGGCELALACDIIIAADNASFGLNETKLGIIPGAGGTDRLPRIIGHsKAMEMLLLGRR 158
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
4HDT_A        175 FSGADAIVMGFADHYVPHDKIDEFTRAVIADGVDAALAAHAQ 216
Cdd:pfam00378 159 ISAQEALKWGLVDKVVPEDQLLDEARELAEKLAEKSPAALAQ 200
PRK07657 PRK07657
enoyl-CoA hydratase; Provisional
9-197 3.96e-19

enoyl-CoA hydratase; Provisional


Pssm-ID: 181069  Cd Length: 260  Bit Score: 84.40  E-value: 3.96e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         9 EDVLVNV-EGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDvvaIYHSAKADGAEA 87
Cdd:PRK07657   3 QNISVDYvTPHVVKITLNRPRAANALSLALLEELQNILTQINEEANVRVVILTGAGEKAFCAGAD---LKERAGMNEEQV 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        88 RRFWFDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTyllSRAPGKLGLH 167
Cdd:PRK07657  80 RHAVSLIRTTMEMVEQLPQPVIAAINGIALGGGLELALACDFRIAAESASLGLTETTLAIIPGAGGT---QRLPRLIGVG 156
                        170       180       190
                 ....*....|....*....|....*....|....
4HDT_A       168 AA----LTGAPFSGADAIVMGFADHYVPHDKIDE 197
Cdd:PRK07657 157 RAkeliYTGRRISAQEAKEIGLVEFVVPAHLLEE 190
PRK07658 PRK07658
enoyl-CoA hydratase; Provisional
13-311 2.69e-18

enoyl-CoA hydratase; Provisional


Pssm-ID: 181070  Cd Length: 257  Bit Score: 81.99  E-value: 2.69e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        13 VNVEGGVGLLTLNRPKAiNSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIyhSAKADGAEARRFWF 92
Cdd:PRK07658   6 VRVEDHVAVITLNHPPA-NALSSQVLHELSELLDQVEKDDNVRVVVIHGEG-RFFSAGADIKEF--TSVTEAEQATELAQ 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        93 DEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKL-GLHAALT 171
Cdd:PRK07658  82 LGQVTFERVEKFSKPVIAAIHGAALGGGLELAMSCHIRFATESAKLGLPELNLGLIPGFAGTQRLPRYVGKAkALEMMLT 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       172 GAPFSGADAIVMGFADHYVPHDKIDEFTRAViadgvdaalaahaqeppasplaeqrswidecytgdtvadiiaalrahda 251
Cdd:PRK07658 162 SEPITGAEALKWGLVNGVFPEETLLDDAKKL------------------------------------------------- 192
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       252 paageaADLIATRSPIALSVTLESVrRAAKLQSLEDTLRQEYRVSCASLKSHDLVEGIRA 311
Cdd:PRK07658 193 ------AKKIAGKSPATTRAVLELL-QTTKSSSYYEGVKREAKIFGEVFTSEDAKEGVQA 245
PRK08138 PRK08138
enoyl-CoA hydratase; Provisional
2-193 4.89e-18

enoyl-CoA hydratase; Provisional


Pssm-ID: 236162  Cd Length: 261  Bit Score: 81.25  E-value: 4.89e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         2 SMVTAKNEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGaGERGLCAGGDVVAIYhSAK 81
Cdd:PRK08138   1 MMSTATDVVLLERPADGVALLRLNRPEARNALNMEVRQQLAEHFTELSEDPDIRAIVLTG-GEKVFAAGADIKEFA-TAG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        82 ADGAEARRfwfdEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAP 161
Cdd:PRK08138  79 AIEMYLRH----TERYWEAIAQCPKPVIAAVNGYALGGGCELAMHADIIVAGESASFGQPEIKVGLMPGAGGTQRLVRAV 154
                        170       180       190
                 ....*....|....*....|....*....|...
4HDT_A       162 GKL-GLHAALTGAPFSGADAIVMGFADHYVPHD 193
Cdd:PRK08138 155 GKFkAMRMALTGCMVPAPEALAIGLVSEVVEDE 187
PaaB1 TIGR02280
phenylacetate degradation probable enoyl-CoA hydratase paaB; This family of proteins are found ...
11-224 7.10e-18

phenylacetate degradation probable enoyl-CoA hydratase paaB; This family of proteins are found within apparent operons for the degradation of phenylacetic acid. These proteins contain the enoyl-CoA hydratase domain as detected by pfam00378. This activity is consistent with current hypotheses for the degradation pathway, which involve the ligation of phenylacetate with coenzyme A (paaF), hydroxylation (paaGHIJK), ring-opening (paaN) and degradation of the resulting fatty acid-like compound to a Krebs cycle intermediate (paaABCDE).


Pssm-ID: 274065  Cd Length: 257  Bit Score: 80.67  E-value: 7.10e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         11 VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHSAKAD---GAEA 87
Cdd:TIGR02280   1 ILSHLEKGVATLTLNRPDKLNSFNAEMHAELAEALKRVERDDTARALLLTGAG-RGFCAGQDLSDRNVTPGPApdlGMTV 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         88 RRFWFDEYRLnahIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGK---L 164
Cdd:TIGR02280  80 ERFYNPLVRR---LAALPKPVICAVNGVAAGAGANLALAGDIVIAARSAKFIQAFSKLGLIPDSGGTWLLPRLVGRaraM 156
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        165 GLhaALTGAPFSGADAIVMGFADHYVpHDkideftrAVIADGVDaALAAHAQEPPASPLA 224
Cdd:TIGR02280 157 GL--ALLGNKLSAEQAHEWGLIWQVV-DD-------ATLMDEAQ-ALARHLATQPTRGLG 205
PRK05809 PRK05809
3-hydroxybutyryl-CoA dehydratase; Validated
10-162 8.41e-18

3-hydroxybutyryl-CoA dehydratase; Validated


Pssm-ID: 180270  Cd Length: 260  Bit Score: 80.56  E-value: 8.41e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        10 DVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDvvaIYHSAKADGAEARR 89
Cdd:PRK05809   5 NVILEKEGHIAVVTINRPKALNALNSETLKELDTVLDDIENDDNVYAVILTGAGEKAFVAGAD---ISEMKDLNEEEGRK 81
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
4HDT_A        90 FWFDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPG 162
Cdd:PRK05809  82 FGLLGNKVFRKLENLDKPVIAAINGFALGGGCELSMACDIRIASEKAKFGQPEVGLGITPGFGGTQRLARIVG 154
PRK07799 PRK07799
enoyl-CoA hydratase; Provisional
5-323 1.29e-16

enoyl-CoA hydratase; Provisional


Pssm-ID: 181122  Cd Length: 263  Bit Score: 77.06  E-value: 1.29e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         5 TAKNEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGErGLCAGGDVVAIyhSAKADG 84
Cdd:PRK07799   1 MEGGPHALVEQRGHTLIVTMNRPEARNALSTEMLRIMVDAWDRVDNDPDIRSCILTGAGG-AFCAGMDLKAA--TKKPPG 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        85 AEARRFWFDEYRLNAHI-GRYP-KPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRA-P 161
Cdd:PRK07799  78 DSFKDGSYDPSRIDALLkGRRLtKPLIAAVEGPAIAGGTEILQGTDIRVAGESAKFGISEAKWSLFPMGGSAVRLVRQiP 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       162 GKLGLHAALTGAPFSGADAIVMGFADHYVPhdkideftraviaDGvdAALAahaqeppasplaeqrswidecytgdtvad 241
Cdd:PRK07799 158 YTVACDLLLTGRHITAAEAKEIGLIGHVVP-------------DG--QALD----------------------------- 193
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       242 iiaalrahdapAAGEAADLIATRSPIALSVTLESVRRAAKLQSlEDTLRQEYRVSCASLKSHDLVEGIRAqLVDKdRNPK 321
Cdd:PRK07799 194 -----------KALELAELINANGPLAVQAILRTIRETEGMHE-NEAFKIDTKIGIPVFLSEDAKEGPRA-FAEK-RAPN 259

                 ..
4HDT_A       322 WR 323
Cdd:PRK07799 260 FQ 261
PRK07260 PRK07260
enoyl-CoA hydratase; Provisional
9-203 7.49e-15

enoyl-CoA hydratase; Provisional


Pssm-ID: 180910  Cd Length: 255  Bit Score: 72.08  E-value: 7.49e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         9 EDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHSAKADGAEAr 88
Cdd:PRK07260   2 EHIIYEVEDDLATLTLNRPEVSNGFNIPMCQEILEALRLAEEDPSVRFLLINANG-KVFSVGGDLVEMKRAVDEDDVQS- 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        89 rfWFDEYRLNAHIG----RYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPG-K 163
Cdd:PRK07260  80 --LVKIAELVNEISfaikQLPKPVIMCVDGAVAGAAANMAVAADFCIASTKTKFIQAFVGVGLAPDAGGLFLLTRAIGlN 157
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
4HDT_A       164 LGLHAALTGAPFSGADAIVMGFADHYVPHDKIDEFTRAVI 203
Cdd:PRK07260 158 RATHLAMTGEALTAEKALEYGFVYRVAESEKLEKTCEQLL 197
PRK05862 PRK05862
enoyl-CoA hydratase; Provisional
9-197 7.82e-15

enoyl-CoA hydratase; Provisional


Pssm-ID: 180295  Cd Length: 257  Bit Score: 72.00  E-value: 7.82e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         9 EDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAgERGLCAGGDVVAIYHSAKADGAEAR 88
Cdd:PRK05862   4 ETILVETRGRVGLITLNRPKALNALNDALMDELGAALAAFDADEGIGAIVITGS-EKAFAAGADIKEMADLSFMDVYKGD 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        89 RF--WfdeyrlnAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKL-G 165
Cdd:PRK05862  83 YItnW-------EKVARIRKPVIAAVAGYALGGGCELAMMCDIIIAADTAKFGQPEIKLGVLPGMGGSQRLTRAVGKAkA 155
                        170       180       190
                 ....*....|....*....|....*....|...
4HDT_A       166 LHAALTGAPFSGADAIVMGFADHYVPHDK-IDE 197
Cdd:PRK05862 156 MDLCLTGRMMDAAEAERAGLVSRVVPADKlLDE 188
PRK05995 PRK05995
enoyl-CoA hydratase; Provisional
8-258 7.98e-15

enoyl-CoA hydratase; Provisional


Pssm-ID: 235664  Cd Length: 262  Bit Score: 72.26  E-value: 7.98e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         8 NEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHSAKADGAEA 87
Cdd:PRK05995   3 YETLEIEQRGQVATVTLNRPDVRNAFNETVIAELTAAFRALDADDSVRAVVLAGAG-KAFCAGADLNWMKKMAGYSDDEN 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        88 RRfwfDEYRLNA---HIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKL 164
Cdd:PRK05995  82 RA---DARRLADmlrAIYRCPKPVIARVHGDAYAGGMGLVAACDIAVAADHAVFCLSEVRLGLIPATISPYVIRAMGERA 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       165 GLHAALTGAPFSGADAIVMGFADHYVPHD----KIDEFTRAVIADGVDAALAAHA--QEPPASPlaeqrswIDECYTGDT 238
Cdd:PRK05995 159 ARRYFLTAERFDAAEALRLGLVHEVVPAEaldaKVDELLAALVANSPQAVRAGKRlvRDVAGRP-------IDAALIADT 231
                        250       260
                 ....*....|....*....|
4HDT_A       239 vADIIAALRAHDAPAAGEAA 258
Cdd:PRK05995 232 -ASRIALIRATEEAREGVAA 250
PRK09674 PRK09674
enoyl-CoA hydratase-isomerase; Provisional
9-226 8.52e-14

enoyl-CoA hydratase-isomerase; Provisional


Pssm-ID: 182026  Cd Length: 255  Bit Score: 69.02  E-value: 8.52e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         9 EDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAgERGLCAGGDVVAIYHSAKADGAEAR 88
Cdd:PRK09674   2 SELLVSRQQRVLLLTLNRPEARNALNNALLTQLVNELEAAATDTSIGVCVITGN-ARFFAAGADLNEMAEKDLAATLNDP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        89 RfwfdeYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGK-LGLH 167
Cdd:PRK09674  81 R-----PQLWQRLQAFNKPLIAAVNGYALGAGCELALLCDIVIAGENARFGLPEITLGIMPGAGGTQRLIRSVGKsLASQ 155
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*....
4HDT_A       168 AALTGAPFSGADAIVMGFADHYVPHDKIDEFtraviADGVDAALAAHAqePPASPLAEQ 226
Cdd:PRK09674 156 MVLTGESITAQQAQQAGLVSEVFPPELTLER-----ALQLASKIARHS--PLALRAAKQ 207
PRK07468 PRK07468
enoyl-CoA hydratase; Provisional
18-263 9.94e-14

enoyl-CoA hydratase; Provisional


Pssm-ID: 180987  Cd Length: 262  Bit Score: 68.93  E-value: 9.94e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        18 GVGLLTLNRPKAINSLTHGMV---TTMAERLAAwenDDSVRAVLLTGAGeRGLCAGGDVVAIYHSAKADGA----EARRF 90
Cdd:PRK07468  14 GVATLTLNRPEKHNALSARMIaelTTAARRLAA---DAAVRVVVLTGAG-KSFCAGGDLGWMRAQMTADRAtrieEARRL 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        91 wfdEYRLNAhIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKLGLHAAL 170
Cdd:PRK07468  90 ---AMMLKA-LNDLPKPLIGRIQGQAFGGGVGLISVCDVAIAVSGARFGLTETRLGLIPATISPYVVARMGEANARRVFM 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       171 TGAPFSGADAIVMGFADHYVPHDKIDEFTRAVIADGVDAALAAhaqeppaspLAEQRSWIDECYTGDTVADIIAALRA-H 249
Cdd:PRK07468 166 SARLFDAEEAVRLGLLSRVVPAERLDAAVEAEVTPYLSCAPGA---------VAAAKALVRALGAPIDEAVIDATIEAlA 236
                        250
                 ....*....|....
4HDT_A       250 DAPAAGEAADLIAT 263
Cdd:PRK07468 237 DTWETEEAREGIAA 250
PRK06210 PRK06210
enoyl-CoA hydratase; Provisional
9-205 2.91e-13

enoyl-CoA hydratase; Provisional


Pssm-ID: 180472  Cd Length: 272  Bit Score: 67.81  E-value: 2.91e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         9 EDVLVNV-EGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHSAKADGaeA 87
Cdd:PRK06210   5 DAVLYEVaDSGVAVITLNRPDRLNAWTPVMEAEVYAAMDRAEADPAVRVIVLTGAG-RGFCAGADMGELQTIDPSDG--R 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        88 RRFWFDEYRLNAH---IGRY------PKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLS 158
Cdd:PRK06210  82 RDTDVRPFVGNRRpdyQTRYhfltalRKPVIAAINGACAGIGLTHALMCDVRFAADGAKFTTAFARRGLIAEHGISWILP 161
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|..
4HDT_A       159 RAPGklglHAA-----LTGAPFSGADAIVMGFADHYVPHDKIDEFTRAVIAD 205
Cdd:PRK06210 162 RLVG----HANaldllLSARTFYAEEALRLGLVNRVVPPDELMERTLAYAED 209
PRK08140 PRK08140
enoyl-CoA hydratase; Provisional
9-180 4.45e-13

enoyl-CoA hydratase; Provisional


Pssm-ID: 236163  Cd Length: 262  Bit Score: 67.25  E-value: 4.45e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         9 EDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWEnDDSVRAVLLTGAGeRGLCAGGD----VVAIYHSAKADG 84
Cdd:PRK08140   4 ETILLAIEAGVATLTLNRPDKLNSFTREMHRELREALDQVE-DDGARALLLTGAG-RGFCAGQDladrDVTPGGAMPDLG 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        85 AEARRFWFDEYRLnahIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGK- 163
Cdd:PRK08140  82 ESIETFYNPLVRR---LRALPLPVIAAVNGVAAGAGANLALACDIVLAARSASFIQAFVKIGLVPDSGGTWFLPRLVGMa 158
                        170
                 ....*....|....*....
4HDT_A       164 --LGLhaALTGAPFSGADA 180
Cdd:PRK08140 159 raLGL--ALLGEKLSAEQA 175
PLN02888 PLN02888
enoyl-CoA hydratase
1-75 6.83e-13

enoyl-CoA hydratase


Pssm-ID: 215480  Cd Length: 265  Bit Score: 66.70  E-value: 6.83e-13
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
4HDT_A         1 GSMVTAKNEDVLVNVE-GGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVA 75
Cdd:PLN02888   1 TMTQTVSENLILVPKSrNGIATITINRPKALNALTRPMMVELAAAFKRLDEDDSVKVIILTGSG-RAFCSGVDLTA 75
PRK06127 PRK06127
enoyl-CoA hydratase; Provisional
1-215 7.94e-13

enoyl-CoA hydratase; Provisional


Pssm-ID: 235705  Cd Length: 269  Bit Score: 66.65  E-value: 7.94e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         1 GSMVTAKNEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIYHSA 80
Cdd:PRK06127   3 MSSISSPTGKLLAEKTGGLGRITFNNPARHNAMSLDMWEALPQALAAAEDDDAIRVVVLTGAGEKAFVSGADISQFEESR 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        81 KADGAEARRFWFDEYRLNAhIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRa 160
Cdd:PRK06127  83 SDAEAVAAYEQAVEAAQAA-LADYAKPTIACIRGYCIGGGMGIALACDIRIAAEDSRFGIPAARLGLGYGYDGVKNLVD- 160
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*....
4HDT_A       161 pgKLGLHAA----LTGAPFSGADAIVMGFADHYVPHDKIDEFTRAVIadgvdAALAAHA 215
Cdd:PRK06127 161 --LVGPSAAkdlfYTARRFDAAEALRIGLVHRVTAADDLETALADYA-----ATIAGNA 212
PRK07511 PRK07511
enoyl-CoA hydratase; Provisional
8-178 1.63e-12

enoyl-CoA hydratase; Provisional


Pssm-ID: 181009  Cd Length: 260  Bit Score: 65.40  E-value: 1.63e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         8 NEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDV------VAIYHSAK 81
Cdd:PRK07511   2 SAELLSRREGSTLVLTLSNPGARNALHPDMYAAGIEALNTAERDPSIRAVVLTGAG-GFFCAGGNLnrllenRAKPPSVQ 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        82 ADGAEARRFWFDEYRLnahigrYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRA- 160
Cdd:PRK07511  81 AASIDGLHDWIRAIRA------FPKPVIAAVEGAAAGAGFSLALACDLLVAARDAKFVMAYVKVGLTPDGGGSWFLARAl 154
                        170
                 ....*....|....*...
4HDT_A       161 PGKLGLHAALTGAPFSGA 178
Cdd:PRK07511 155 PRQLATELLLEGKPISAE 172
PRK06144 PRK06144
enoyl-CoA hydratase; Provisional
5-323 3.15e-12

enoyl-CoA hydratase; Provisional


Pssm-ID: 180424  Cd Length: 262  Bit Score: 64.63  E-value: 3.15e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         5 TAKNEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIyhSAKADG 84
Cdd:PRK06144   4 TTSTDELLLEVRGGIARITFNRPAARNAMTWAMYEGLAEICEAIAADPSIRAVVLRGAGDKAFVAGTDIAQF--RAFSTA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        85 AEARRFwfdEYRLNAHIGRY---PKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPevgigfIPDVGGTYLlsrAP 161
Cdd:PRK06144  82 EDAVAY---ERRIDRVLGALeqlRVPTIAAIAGACVGGGAAIAAACDLRIATPSARFGFP------IARTLGNCL---SM 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       162 GKLGLHAALTGAPfSGADAIvmgfadhyvphdkideFTRAVIadGVDAALAAHaqeppasplaeqrswidecYTGDTVAD 241
Cdd:PRK06144 150 SNLARLVALLGAA-RVKDML----------------FTARLL--EAEEALAAG-------------------LVNEVVED 191
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       242 iiAALRAhdapAAGEAADLIATRSPIALSVTLESVRR--AAKLQSLEDTLRQEYrvscaslKSHDLVEGIRAqLVDKdRN 319
Cdd:PRK06144 192 --AALDA----RADALAELLAAHAPLTLRATKEALRRlrREGLPDGDDLIRMCY-------MSEDFREGVEA-FLEK-RP 256

                 ....
4HDT_A       320 PKWR 323
Cdd:PRK06144 257 PKWK 260
PRK07659 PRK07659
enoyl-CoA hydratase; Provisional
4-323 8.31e-12

enoyl-CoA hydratase; Provisional


Pssm-ID: 236073  Cd Length: 260  Bit Score: 63.51  E-value: 8.31e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         4 VTAKNEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERL-AAWENDDSVraVLLTGAGeRGLCAGGDVVAIYHSAKA 82
Cdd:PRK07659   1 VTSKMESVVVKYEGRVATIMLNRPEALNALDEPMLKELLQALkEVAESSAHI--VVLRGNG-RGFSAGGDIKMMLSSNDE 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        83 DGaearrfwFDE------------YRLnahigryPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPD 150
Cdd:PRK07659  78 SK-------FDGvmntiseivvtlYTM-------PKLTISAIHGPAAGLGLSIALTADYVIADISAKLAMNFIGIGLIPD 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       151 VGGTYLLSRapgKLGLHAA----LTGAPFSGADAIVMGFADhyvphdkideftrAVIADGVDAALAAHAQEPPASPLAEq 226
Cdd:PRK07659 144 GGGHFFLQK---RVGENKAkqiiWEGKKLSATEALDLGLID-------------EVIGGDFQTAAKQKISEWLQKPLKA- 206
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       227 rswidecytgdtvadiiaalrahdapaageaadLIATRSpIALSVTLEsvrraaklqSLEDTLRQEYRVSCASLKSHDLV 306
Cdd:PRK07659 207 ---------------------------------MIETKQ-IYCELNRS---------QLEQVLQLEKRAQYAMRQTADHK 243
                        330
                 ....*....|....*..
4HDT_A       307 EGIRAQLvdKDRNPKWR 323
Cdd:PRK07659 244 EGIRAFL--EKRLPVFK 258
PRK06494 PRK06494
enoyl-CoA hydratase; Provisional
11-323 1.26e-11

enoyl-CoA hydratase; Provisional


Pssm-ID: 180591  Cd Length: 259  Bit Score: 62.75  E-value: 1.26e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        11 VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVvaiyhsaKADGAEARRF 90
Cdd:PRK06494   6 STVERKGHVTIVTLNRPEVMNALHLDAHFELEEVFDDFAADPEQWVAIVTGAGDKAFSAGNDL-------KEQAAGGKRG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        91 WfDEYRLNAHIGRYP--KPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRA-PGKLGLH 167
Cdd:PRK06494  79 W-PESGFGGLTSRFDldKPIIAAVNGVAMGGGFELALACDLIVAAENATFALPEPRVGLAALAGGLHRLPRQiGLKRAMG 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       168 AALTGAPFSGADAIVMGFADHYVPHDKIDEftraviadgvdaalaahaqeppasplaeqrswidecytgdtvadiiaalr 247
Cdd:PRK06494 158 MILTGRRVTAREGLELGFVNEVVPAGELLA-------------------------------------------------- 187
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
4HDT_A       248 ahdapAAGEAADLIATRSPIALSVTLESVRRAAKLqSLEDTL--RQEYRVSCASLKSHDLVEGIRAqLVDKdRNPKWR 323
Cdd:PRK06494 188 -----AAERWADDILACSPLSIRASKQAVYRGLEV-SLEEAItaQRDYPAVEARRASQDYIEGPKA-FAEK-RPPRWK 257
PRK08139 PRK08139
enoyl-CoA hydratase; Validated
11-204 1.54e-11

enoyl-CoA hydratase; Validated


Pssm-ID: 181249  Cd Length: 266  Bit Score: 62.65  E-value: 1.54e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        11 VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVvaiyhsAKADGAEARRF 90
Cdd:PRK08139  13 LLREDRDGVATLTLNRPQAFNALSEAMLAALQAALDAIAADPSVRVVVLAAAG-KAFCAGHDL------KEMRAARGLAY 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        91 WFDEYRLNAH----IGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFI---PDVGgtylLSRA-PG 162
Cdd:PRK08139  86 FRALFARCSRvmqaIVALPQPVIARVHGIATAAGCQLVASCDLAVAADTARFAVPGVNIGLFcstPMVA----LSRNvPR 161
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|..
4HDT_A       163 KLGLHAALTGAPFSGADAIVMGFADHYVPHDKIDEFTRAVIA 204
Cdd:PRK08139 162 KQAMEMLLTGEFIDAATAREWGLVNRVVPADALDAAVARLAA 203
PRK09120 PRK09120
p-hydroxycinnamoyl CoA hydratase/lyase; Validated
2-204 1.56e-11

p-hydroxycinnamoyl CoA hydratase/lyase; Validated


Pssm-ID: 236383  Cd Length: 275  Bit Score: 62.72  E-value: 1.56e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         2 SMVTAKNEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGErGLCAGGDVVAIYHSAK 81
Cdd:PRK09120   1 MSYENRWDTVKVEVEDGIAWVTLNRPEKRNAMSPTLNREMIDVLDALEFDDDAGVLVLTGAGD-AWSAGMDLKEYFRETD 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        82 ADG----AEARR---FWFDEYRLnahigrYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPdvGGt 154
Cdd:PRK09120  80 AQPeilqERIRReayGWWRRLRW------YQKPTIAMVNGWCFGGGFSPLVACDLAIAADEAQFGLSEINWGIPP--GG- 150
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*
4HDT_A       155 yLLSRA-----PGKLGLHAALTGAPFSGADAIVMGFADHYVPHDKIDEFTRAVIA 204
Cdd:PRK09120 151 -GVSKAmadtvGHRDALYYIMTGETFTGRKAAEMGLVNESVPLAQLRARTRELAA 204
PRK09245 PRK09245
enoyl-CoA hydratase; Provisional
11-195 2.38e-11

enoyl-CoA hydratase; Provisional


Pssm-ID: 181723  Cd Length: 266  Bit Score: 61.91  E-value: 2.38e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        11 VLVNVEGGVGLLTLNRPKAINSLT-HGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHSAKADG---AE 86
Cdd:PRK09245   5 LLVERDGHIVTLTMNRPETRNALSdNDAVDALVAACAAINADRSVRAVILTGAG-TAFSSGGNVKDMRARVGAFGgspAD 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        87 ARrfwfDEYRLNahIGRYPK-------PYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSR 159
Cdd:PRK09245  84 IR----QGYRHG--IQRIPLalynlevPVIAAVNGPAIGAGCDLACMCDIRIASETARFAESFVKLGLIPGDGGAWLLPR 157
                        170       180       190
                 ....*....|....*....|....*....|....*..
4HDT_A       160 APG-KLGLHAALTGAPFSGADAIVMGFADHYVPHDKI 195
Cdd:PRK09245 158 IIGmARAAEMAFTGDAIDAATALEWGLVSRVVPADQL 194
PRK06072 PRK06072
enoyl-CoA hydratase; Provisional
11-185 4.12e-11

enoyl-CoA hydratase; Provisional


Pssm-ID: 168377  Cd Length: 248  Bit Score: 60.95  E-value: 4.12e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        11 VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVvaiyHSAKADGAEARRF 90
Cdd:PRK06072   2 IKVESREGYAIVTMSRPDKLNALNLEMRNEFISKLKQINADPKIRVVIVTGEG-RAFCVGADL----SEFAPDFAIDLRE 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        91 WFdeYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKLGLHAAL 170
Cdd:PRK06072  77 TF--YPIIREIRFSDKIYISAINGVTAGACIGIALSTDFKFASRDVKFVTAFQRLGLASDTGVAYFLLKLTGQRFYEILV 154
                        170
                 ....*....|....*
4HDT_A       171 TGAPFSGADAIVMGF 185
Cdd:PRK06072 155 LGGEFTAEEAERWGL 169
PRK06190 PRK06190
enoyl-CoA hydratase; Provisional
11-72 5.27e-11

enoyl-CoA hydratase; Provisional


Pssm-ID: 235733  Cd Length: 258  Bit Score: 61.14  E-value: 5.27e-11
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
4HDT_A        11 VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGD 72
Cdd:PRK06190   6 LLVETHDRVRTLTLNRPEARNALSAALRRALFAALAEADADDDVDVVVLTGAD-PAFCAGLD 66
PRK07509 PRK07509
enoyl-CoA hydratase; Provisional
8-213 1.60e-10

enoyl-CoA hydratase; Provisional


Pssm-ID: 181008  Cd Length: 262  Bit Score: 59.51  E-value: 1.60e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         8 NEDVLVNVEGGVGLLTLNRPKAINSLTHGM---VTTMAERLAAwenDDSVRAVLLTGAGeRGLCAGGDVVAIyhsAKADG 84
Cdd:PRK07509   2 MDRVSVTIEDGIADVRLNRPDKMNALDFAMfeeLIATIKRLKK---DRGIRAVILSGEG-GAFCAGLDVKSV---ASSPG 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        85 AEARRFWfdeYRL--NAHIGRY--------PKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGT 154
Cdd:PRK07509  75 NAVKLLF---KRLpgNANLAQRvslgwrrlPVPVIAALEGVCFGGGLQIALGADIRIAAPDTKLSIMEAKWGLVPDMAGT 151
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
4HDT_A       155 YLLSRAPGK-LGLHAALTGAPFSGADAIVMGFADHYV--PHDKIDEFTRAVIADGVDAALAA 213
Cdd:PRK07509 152 VSLRGLVRKdVARELTYTARVFSAEEALELGLVTHVSddPLAAALALAREIAQRSPDAIAAA 213
PRK08260 PRK08260
enoyl-CoA hydratase; Provisional
9-100 2.40e-10

enoyl-CoA hydratase; Provisional


Pssm-ID: 236206  Cd Length: 296  Bit Score: 59.63  E-value: 2.40e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         9 EDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVvaiyhsakadGAEAR 88
Cdd:PRK08260   4 ETIRYDVADGIATITLNRPDKLNAFTVTMARELIEAFDAADADDAVRAVIVTGAG-RAFCAGADL----------SAGGN 72
                         90
                 ....*....|..
4HDT_A        89 RFWFDEYRLNAH 100
Cdd:PRK08260  73 TFDLDAPRTPVE 84
badI TIGR03210
2-ketocyclohexanecarboxyl-CoA hydrolase; Members of this protein family are ...
9-196 4.53e-10

2-ketocyclohexanecarboxyl-CoA hydrolase; Members of this protein family are 2-ketocyclohexanecarboxyl-CoA hydrolase, a ring-opening enzyme that acts in catabolism of molecules such as benzoyl-CoA and cyclohexane carboxylate. It converts -ketocyclohexanecarboxyl-CoA to pimelyl-CoA. It is not sensitive to oxygen.


Pssm-ID: 132254  Cd Length: 256  Bit Score: 58.03  E-value: 4.53e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A          9 EDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAiyHSAKADGAEAR 88
Cdd:TIGR03210   2 EDILYEKRNGIAWIMINRPAKMNAFRGQTCDELIHALKDAGYDRQIGVIVLAGAGDKAFCTGGDQST--HDGGYDGRGTI 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         89 RFWFDEyrLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDttKMAMPEVGigfiPDVG------GTYLLSRAPG 162
Cdd:TIGR03210  80 GLPMEE--LHSAIRDVPKPVIARVQGYAIGGGNVLVTICDLTIASE--KAQFGQVG----PKVGsvdpgyGTALLARVVG 151
                         170       180       190
                  ....*....|....*....|....*....|....*
4HDT_A        163 -KLGLHAALTGAPFSGADAIVMGFADHYVPHDKID 196
Cdd:TIGR03210 152 eKKAREIWYLCRRYTAQEALAMGLVNAVVPHDQLD 186
PRK08252 PRK08252
enoyl-CoA hydratase; Provisional
9-191 9.38e-10

enoyl-CoA hydratase; Provisional


Pssm-ID: 181325  Cd Length: 254  Bit Score: 57.31  E-value: 9.38e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         9 EDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERgLCAGGDVVAiYHSAKADGAEAR 88
Cdd:PRK08252   3 DEVLVERRGRVLIITINRPEARNAVNAAVAQGLAAALDELDADPDLSVGILTGAGGT-FCAGMDLKA-FARGERPSIPGR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        89 RFwfdeyrlnAHIGRYP--KPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLL-SRAPGKLG 165
Cdd:PRK08252  81 GF--------GGLTERPprKPLIAAVEGYALAGGFELALACDLIVAARDAKFGLPEVKRGLVAAGGGLLRLpRRIPYHIA 152
                        170       180
                 ....*....|....*....|....*.
4HDT_A       166 LHAALTGAPFSGADAIVMGFADHYVP 191
Cdd:PRK08252 153 MELALTGDMLTAERAHELGLVNRLTE 178
PRK06143 PRK06143
enoyl-CoA hydratase; Provisional
16-196 1.57e-09

enoyl-CoA hydratase; Provisional


Pssm-ID: 180423  Cd Length: 256  Bit Score: 56.58  E-value: 1.57e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        16 EGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDvvaIYHSAKADGAEARRFWFDEY 95
Cdd:PRK06143  14 DRGVATLTIRNAGSLNILGTPVILALTQALRWLAADPDVRVLVLRGAGEKAFIGGAD---IKEMATLDQASAEAFISRLR 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        96 RLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGfIPDVGGTYLLSRAPGKlgLHAA---LTG 172
Cdd:PRK06143  91 DLCDAVRHFPVPVIARIPGWCLGGGLELAAACDLRIAAHDAQFGMPEVRVG-IPSVIHAALLPRLIGW--ARTRwllLTG 167
                        170       180
                 ....*....|....*....|....
4HDT_A       173 APFSGADAIVMGFADHYVPHDKID 196
Cdd:PRK06143 168 ETIDAAQALAWGLVDRVVPLAELD 191
PRK05870 PRK05870
enoyl-CoA hydratase; Provisional
9-228 2.53e-09

enoyl-CoA hydratase; Provisional


Pssm-ID: 180298  Cd Length: 249  Bit Score: 55.89  E-value: 2.53e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         9 EDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHSAKADGAEAR 88
Cdd:PRK05870   3 DPVLLDVDDGVALITVNDPDRRNAVTAEMSAQLRAAVAAAEADPDVHALVVTGAG-KAFCAGADLTALGAAPGRPAEDGL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        89 RFWFDEYRLNAHIgryPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPG-KLGLH 167
Cdd:PRK05870  82 RRIYDGFLAVASC---PLPTIAAVNGAAVGAGLNLALAADVRIAGPKALFDARFQKLGLHPGGGATWMLQRAVGpQVARA 158
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
4HDT_A       168 AALTGAPFSGADAIVMGFAdhyvphdkideftRAVIADGVDAAL---AAHAQEPPASPLAEQRS 228
Cdd:PRK05870 159 ALLFGMRFDAEAAVRHGLA-------------LMVADDPVAAALelaAGPAAAPRELVLATKAS 209
PRK07396 PRK07396
dihydroxynaphthoic acid synthetase; Validated
9-72 4.59e-09

dihydroxynaphthoic acid synthetase; Validated


Pssm-ID: 180958  Cd Length: 273  Bit Score: 55.28  E-value: 4.59e-09
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
4HDT_A         9 EDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGD 72
Cdd:PRK07396  13 EDILYKSADGIAKITINRPEVRNAFRPKTVKEMIDAFADARDDDNIGVIILTGAGDKAFCSGGD 76
PRK08258 PRK08258
enoyl-CoA hydratase; Provisional
12-76 7.64e-09

enoyl-CoA hydratase; Provisional


Pssm-ID: 181329  Cd Length: 277  Bit Score: 54.59  E-value: 7.64e-09
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
4HDT_A        12 LVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAI 76
Cdd:PRK08258  20 LWEVDDGVATITLNRPERKNPLTFESYAELRDLFRELVYADDVKAVVLTGAG-GNFCSGGDVHEI 83
PLN02600 PLN02600
enoyl-CoA hydratase
18-191 1.17e-08

enoyl-CoA hydratase


Pssm-ID: 178210  Cd Length: 251  Bit Score: 54.04  E-value: 1.17e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        18 GVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGgdvvaiyhsakADGAEARRFWFDEYRL 97
Cdd:PLN02600   4 GIVELRLDRPEAKNAIGKEMLRGLRSAFEKIQADASARVVMLRSSVPGVFCAG-----------ADLKERRKMSPSEVQK 72
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        98 NAHIGRY--------PKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGK-LGLHA 168
Cdd:PLN02600  73 FVNSLRStfsslealSIPTIAVVEGAALGGGLELALSCDLRICGEEAVFGLPETGLAIIPGAGGTQRLPRLVGRsRAKEL 152
                        170       180
                 ....*....|....*....|...
4HDT_A       169 ALTGAPFSGADAIVMGFADHYVP 191
Cdd:PLN02600 153 IFTGRRIGAREAASMGLVNYCVP 175
PRK05864 PRK05864
enoyl-CoA hydratase; Provisional
18-72 1.87e-08

enoyl-CoA hydratase; Provisional


Pssm-ID: 168278  Cd Length: 276  Bit Score: 53.68  E-value: 1.87e-08
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
4HDT_A        18 GVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGD 72
Cdd:PRK05864  19 EIALITLNRPERMNSMAFDVMVPLKEALAEVSYDNSVRVVVLTGAG-RGFSSGAD 72
PRK05981 PRK05981
enoyl-CoA hydratase; Provisional
9-213 8.30e-08

enoyl-CoA hydratase; Provisional


Pssm-ID: 235661  Cd Length: 266  Bit Score: 51.66  E-value: 8.30e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         9 EDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWE-NDDSVRAVLLTGAGeRGLCAG------GDVVAIYHSAK 81
Cdd:PRK05981   4 KKVTLDFDGGVAILTLDHPEVMNAVSIDMLGGLAEALDAIEdGKAEVRCLVLTGAG-RGFCTGanlqgrGSGGRESDSGG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        82 ADGAEARRFWFDEYRLnahIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAP 161
Cdd:PRK05981  83 DAGAALETAYHPFLRR---LRNLPCPIVTAVNGPAAGVGMSFALMGDLILCARSAYFLQAFRRIGLVPDGGSTWLLPRLV 159
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*.
4HDT_A       162 GKL-GLHAALTGAPFSGADAIVMGFADHYVPHDKIDEFTRAV---IADGVDAALAA 213
Cdd:PRK05981 160 GKArAMELSLLGEKLPAETALQWGLVNRVVDDAELMAEAMKLaheLANGPTVALGL 215
PRK03580 PRK03580
carnitinyl-CoA dehydratase; Provisional
9-213 1.65e-07

carnitinyl-CoA dehydratase; Provisional


Pssm-ID: 179599  Cd Length: 261  Bit Score: 50.46  E-value: 1.65e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         9 EDVLVNVEGGVGLLTLNRPKAiNSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIYHSAKADGAEAR 88
Cdd:PRK03580   3 ESLHTTRNGSILEITLDRPKA-NAIDAKTSFAMGEVFLNFRDDPELRVAIITGAGEKFFSAGWDLKAAAEGEAPDADFGP 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        89 RFW--FDEYR-LNahigrypKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGtylLSRAPGKLG 165
Cdd:PRK03580  82 GGFagLTEIFdLD-------KPVIAAVNGYAFGGGFELALAADFIVCADNASFALPEAKLGIVPDSGG---VLRLPKRLP 151
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*
4HDT_A       166 LHAA----LTGAPFSGADAIVMGFADHYVPHDKIDEFTRAV---IADGVDAALAA 213
Cdd:PRK03580 152 PAIAnemvMTGRRMDAEEALRWGIVNRVVPQAELMDRARELaqqLVNSAPLAIAA 206
PLN03214 PLN03214
probable enoyl-CoA hydratase/isomerase; Provisional
17-227 6.07e-07

probable enoyl-CoA hydratase/isomerase; Provisional


Pssm-ID: 215635  Cd Length: 278  Bit Score: 49.11  E-value: 6.07e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        17 GGVGLLTLNRpKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIYHSAKADGAEARRFWFDEYR 96
Cdd:PLN03214  20 GGIAVVWLAK-EPVNSMTLAMWRSLDDALTALENDPTVRGVVFASGLRRDVFTAGNDIAELYAPKTSAARYAEFWLTQTT 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        97 LNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGF-IPDVGGTYLLSRAPG-KLGLHAALTGAP 174
Cdd:PLN03214  99 FLVRLLRSRLATVCAIRGACPAGGCAVSLCCDYRLQTTEGTMGLNEVALGIpVPKFWARLFMGRVIDrKVAESLLLRGRL 178
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|...
4HDT_A       175 FSGADAIVMGFADHYVPHDkideftrAVIADGVdAALAAHAQEPPASPLAEQR 227
Cdd:PLN03214 179 VRPAEAKQLGLIDEVVPAA-------ALMEAAA-SAMERALKLPSAARAATKA 223
PRK08150 PRK08150
enoyl-CoA hydratase; Provisional
11-191 9.19e-07

enoyl-CoA hydratase; Provisional


Pssm-ID: 181254  Cd Length: 255  Bit Score: 48.09  E-value: 9.19e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        11 VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWEndDSVRAVLLTGAGERgLCAGGDVVAIYHSAKADGAEARRF 90
Cdd:PRK08150   4 VSYELDGGVATIGLNRPAKRNALNDGLIAALRAAFARLP--EGVRAVVLHGEGDH-FCAGLDLSELRERDAGEGMHHSRR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        91 WfdeYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGK-LGLHAA 169
Cdd:PRK08150  81 W---HRVFDKIQYGRVPVIAALHGAVVGGGLELASAAHIRVADESTYFALPEGQRGIFVGGGGSVRVPRLIGVaRMTDMM 157
                        170       180
                 ....*....|....*....|..
4HDT_A       170 LTGAPFSGADAIVMGFADHYVP 191
Cdd:PRK08150 158 LTGRVYDAQEGERLGLAQYLVP 179
PLN02664 PLN02664
enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase
14-224 1.22e-06

enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase


Pssm-ID: 178269  Cd Length: 275  Bit Score: 47.97  E-value: 1.22e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        14 NVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERgLCAGGDvVAIYHSAKADGAEARRFWFD 93
Cdd:PLN02664  13 SPNSSVFHLNLNRPSQRNALSLDFFTEFPKALSSLDQNPNVSVIILSGAGDH-FCSGID-LKTLNSISEQSSSGDRGRSG 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        94 EyRLNAHIG----------RYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGgtyLLSRAPGK 163
Cdd:PLN02664  91 E-RLRRKIKflqdaitaieQCRKPVIAAIHGACIGGGVDIVTACDIRYCSEDAFFSVKEVDLAITADLG---TLQRLPSI 166
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
4HDT_A       164 LG----LHAALTGAPFSGADAIVMGFADH-YVPHDKIDEFTRaVIADGVDAalaahaqeppASPLA 224
Cdd:PLN02664 167 VGygnaMELALTGRRFSGSEAKELGLVSRvFGSKEDLDEGVR-LIAEGIAA----------KSPLA 221
PRK07827 PRK07827
enoyl-CoA hydratase; Provisional
11-213 1.77e-06

enoyl-CoA hydratase; Provisional


Pssm-ID: 236109  Cd Length: 260  Bit Score: 47.37  E-value: 1.77e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        11 VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVvaiyHSAKADGAEARRF 90
Cdd:PRK07827   8 VRYAVDGGVATLTLDSPHNRNALSARLVAQLHDGLRAAAADPAVRAVVLTHTG-GTFCAGADL----SEAGGGGGDPYDA 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        91 WFDEYR----LNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKLGL 166
Cdd:PRK07827  83 AVARARemtaLLRAIVELPKPVIAAIDGHVRAGGFGLVGACDIVVAGPESTFALTEARIGVAPAIISLTLLPRLSPRAAA 162
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*..
4HDT_A       167 HAALTGAPFSGADAIVMGFAdhyvphdkideftrAVIADGVDAALAA 213
Cdd:PRK07827 163 RYYLTGEKFGAAEAARIGLV--------------TAAADDVDAAVAA 195
PRK07327 PRK07327
enoyl-CoA hydratase; Provisional
18-112 2.85e-06

enoyl-CoA hydratase; Provisional


Pssm-ID: 235991  Cd Length: 268  Bit Score: 46.94  E-value: 2.85e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        18 GVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIyhSAKADGAEAR-RFWFDEYR 96
Cdd:PRK07327  21 GVLEIVLNGPGALNAADARMHRELADIWRDVDRDPDVRVVLIRGEG-KAFSAGGDLALV--EEMADDFEVRaRVWREARD 97
                         90
                 ....*....|....*.
4HDT_A        97 LNAHIGRYPKPYVSIM 112
Cdd:PRK07327  98 LVYNVINCDKPIVSAI 113
PRK06142 PRK06142
enoyl-CoA hydratase; Provisional
9-313 3.14e-06

enoyl-CoA hydratase; Provisional


Pssm-ID: 235714  Cd Length: 272  Bit Score: 46.89  E-value: 3.14e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         9 EDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHSA----KADG 84
Cdd:PRK06142   6 ESFTVELADHVAQVTLNRPGKGNAMNPAFWSELPEIFRWLDADPEVRAVVLSGSG-KHFSYGIDLPAMAGVFgqlgKDGL 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        85 AEARRFWFDEYR-----LNAhIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGtylLSR 159
Cdd:PRK06142  85 ARPRTDLRREILrlqaaINA-VADCRKPVIAAVQGWCIGGGVDLISACDMRYASADAKFSVREVDLGMVADVGS---LQR 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       160 APGKLGL-HA---ALTGAPFSGADAIVMGFADHyvphdkideftravIADGVDAALAahaqeppasplaeqrswidecyt 235
Cdd:PRK06142 161 LPRIIGDgHLrelALTGRDIDAAEAEKIGLVNR--------------VYDDADALLA----------------------- 203
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
4HDT_A       236 gdtvadiiaalrahdapAAGEAADLIATRSPIALSVTLEsVRRAAKLQSLEDTLRQEYRVSCASLKSHDLVEGIRAQL 313
Cdd:PRK06142 204 -----------------AAHATAREIAAKSPLAVRGTKE-VLDYMRDHRVADGLRYVATWNAAMLPSKDLTEAIAAHM 263
PRK06023 PRK06023
enoyl-CoA hydratase; Provisional
18-204 6.32e-06

enoyl-CoA hydratase; Provisional


Pssm-ID: 168351  Cd Length: 251  Bit Score: 45.55  E-value: 6.32e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        18 GVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAgERGLCAGGDVVAIYHSAKADGAEARRFWFDEYRL 97
Cdd:PRK06023  15 GVQVIRFNRPEKKNAITRAMYATMAKALKAADADDAIRAHVFLGT-EGCFSAGNDMQDFLAAAMGGTSFGSEILDFLIAL 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        98 nahiGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKLGLHAALT-GAPFS 176
Cdd:PRK06023  94 ----AEAEKPIVSGVDGLAIGIGTTIHLHCDLTFASPRSLFRTPFVDLALVPEAGSSLLAPRLMGHQRAFALLAlGEGFS 169
                        170       180
                 ....*....|....*....|....*...
4HDT_A       177 GADAIVMGFADHYVPHDKIDEFTRAVIA 204
Cdd:PRK06023 170 AEAAQEAGLIWKIVDEEAVEAETLKAAE 197
menB TIGR01929
naphthoate synthase (dihydroxynaphthoic acid synthetase); This model represents an enzyme, ...
18-199 7.89e-06

naphthoate synthase (dihydroxynaphthoic acid synthetase); This model represents an enzyme, naphthoate synthase (dihydroxynaphthoic acid synthetase), which is involved in the fifth step of the menaquinone biosynthesis pathway. Together with o-succinylbenzoate-CoA ligase (menE: TIGR01923), this enzyme takes 2-succinylbenzoate and converts it into 1,4-di-hydroxy-2-naphthoate. Included above the trusted cutoff are two enzymes from Arabadopsis thaliana and one from Staphylococcus aureus which are identified as putative enoyl-CoA hydratase/isomerases. These enzymes group with the naphthoate synthases when building a tree and when doing BLAST searches. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]


Pssm-ID: 200143  Cd Length: 259  Bit Score: 45.61  E-value: 7.89e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         18 GVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDV-VAIYHSAKADGAEARRFWFDEYR 96
Cdd:TIGR01929  12 GIAKITINRPQVRNAFRPLTVKEIIQALDDAREDPDIGVVILTGAGDKAFCSGGDQkVRGDYGYIDDSGVHRLNVLDVQR 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         97 LnahIGRYPKPYVSIMDgivmggGVGVGAHGNVRVVTDTT--------KMAMPEVGiGFIPDVGGTYLLSRAPGKLGLHA 168
Cdd:TIGR01929  92 Q---IRTCPKPVIAMVN------GYAIGGGHVLHMMCDLTiaaenarfGQTGPKVG-SFDGGYGSSYMARIVGQKKAREI 161
                         170       180       190
                  ....*....|....*....|....*....|.
4HDT_A        169 ALTGAPFSGADAIVMGFADHYVPHDKIDEFT 199
Cdd:TIGR01929 162 WFLCRQYDAKQALDMGLVNTVVPLADLEKET 192
PRK08290 PRK08290
enoyl-CoA hydratase; Provisional
9-64 1.28e-05

enoyl-CoA hydratase; Provisional


Pssm-ID: 236220  Cd Length: 288  Bit Score: 44.95  E-value: 1.28e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
4HDT_A         9 EDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGE 64
Cdd:PRK08290   4 EYVRYEVAGRIARITLNRPEARNAQNRQMLYELDAAFRRAEADDAVRVIVLAGAGK 59
PRK06563 PRK06563
enoyl-CoA hydratase; Provisional
11-213 1.98e-05

enoyl-CoA hydratase; Provisional


Pssm-ID: 180625  Cd Length: 255  Bit Score: 44.18  E-value: 1.98e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        11 VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGErGLCAGGDVVAIYHSAKADGAEARRF 90
Cdd:PRK06563   1 VSRERRGHVLLIGLDRPAKRNAFDSAMLDDLALALGEYEADDELRVAVLFAHGE-HFTAGLDLADVAPKLAAGGFPFPEG 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        91 WFDEYRLNAHigRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPG-KLGLHAA 169
Cdd:PRK06563  80 GIDPWGTVGR--RLSKPLVVAVQGYCLTLGIELMLAADIVVAADNTRFAQLEVQRGILPFGGATLRFPQAAGwGNAMRYL 157
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|...
4HDT_A       170 LTGAPFSGADAIVMGFADHYVPHDkiDEFTRAV-IAD--------GVDAALAA 213
Cdd:PRK06563 158 LTGDEFDAQEALRLGLVQEVVPPG--EQLERAIeLAEriaraaplGVQATLAS 208
MenB COG0447
1,4-Dihydroxy-2-naphthoyl-CoA synthase [Coenzyme transport and metabolism];
17-199 2.22e-05

1,4-Dihydroxy-2-naphthoyl-CoA synthase [Coenzyme transport and metabolism];


Pssm-ID: 223524  Cd Length: 282  Bit Score: 44.33  E-value: 2.22e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       17 GGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGA--GERGLCAGGD--VVAIYHSAKADGAEARRFWF 92
Cdd:COG0447  27 DGIAKITINRPEVRNAFRPKTVDEMIDAFADARDDPNVGVILLTGNgdGDKAFCSGGDqkVRGDSGGYVDDDGIPRLNVL 106
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       93 DEYRLNAHIgryPKPYVSIMdgivmgGGVGVGAHGNVRVVTDTT--------KMAMPEVGiGFIPDVGGTYLLSRAPGKL 164
Cdd:COG0447 107 DLQRLIRTM---PKPVIAMV------AGYAIGGGHVLHVVCDLTiaadnaifGQTGPKVG-SFDGGYGSSYLARIVGQKK 176
                       170       180       190
                ....*....|....*....|....*....|....*
4HDT_A      165 GLHAALTGAPFSGADAIVMGFADHYVPHDKIDEFT 199
Cdd:COG0447 177 AREIWFLCRQYDAEEALDMGLVNTVVPHADLEKET 211
PRK12478 PRK12478
enoyl-CoA hydratase; Provisional
9-234 2.38e-05

enoyl-CoA hydratase; Provisional


Pssm-ID: 183548  Cd Length: 298  Bit Score: 44.18  E-value: 2.38e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         9 EDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYH----SAKADG 84
Cdd:PRK12478   5 QTLLYTTAGPVATITLNRPEQLNTIVPPMPDEIEAAIGLAERDQDIKVIVLRGAG-RAFSGGYDFGGGFQhwgeAMMTDG 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        85 A--EARRFWFDEYRLNA------HIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPevgigfIPDVGGTYL 156
Cdd:PRK12478  84 RwdPGKDFAMVTARETGptqkfmAIWRASKPVIAQVHGWCVGGASDYALCADIVIASDDAVIGTP------YSRMWGAYL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       157 LSRAPGKLGLHAA----LTGAPFSGADAIVMGFADHYVPHDKIDeftrAVIADgvdaaLAAHAQEPPASPLAEQRSWIDE 232
Cdd:PRK12478 158 TGMWLYRLSLAKVkwhsLTGRPLTGVQAAEAELINEAVPFERLE----ARVAE-----VATELARIPLSQLQAQKLIVNQ 228

                 ..
4HDT_A       233 CY 234
Cdd:PRK12478 229 AY 230
PRK07854 PRK07854
enoyl-CoA hydratase; Provisional
13-72 2.98e-05

enoyl-CoA hydratase; Provisional


Pssm-ID: 236115  Cd Length: 243  Bit Score: 43.47  E-value: 2.98e-05
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        13 VNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWEnDDSVRAVLLTGAGErGLCAGGD 72
Cdd:PRK07854   4 VTRDGQVLTIELQRPERRNALNAELCEELREAVRKAV-DESARAIVLTGQGT-VFCAGAD 61
PRK08272 PRK08272
enoyl-CoA hydratase; Provisional
9-199 3.63e-05

enoyl-CoA hydratase; Provisional


Pssm-ID: 236213  Cd Length: 302  Bit Score: 43.49  E-value: 3.63e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         9 EDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHSAKADGAEAr 88
Cdd:PRK08272  10 KTMTYEVTGRIARITLNRPEKGNAITADTPLELRAAVERADLDPGVHVILVSGAG-KGFCAGYDLSAYAEGSSSGGGGG- 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        89 rfwfDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRV------------VTDTTKMAM--------PEVGIGFI 148
Cdd:PRK08272  88 ----AYPGKRQAVNHLPDDPWDPMIDYQMMSRFVRGFMSLWHAhkptvakvhgycVAGGTDIALhcdqviaaDDAKIGYP 163
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
4HDT_A       149 PdvggtyllSRAPG---------KLGLHAA----LTGAPFSGADAIVMGFADHYVPHDKIDEFT 199
Cdd:PRK08272 164 P--------TRVWGvpatgmwayRLGPQRAkrllFTGDCITGAQAAEWGLAVEAVPPEELDERT 219
PRK05674 PRK05674
gamma-carboxygeranoyl-CoA hydratase; Validated
18-205 1.62e-04

gamma-carboxygeranoyl-CoA hydratase; Validated


Pssm-ID: 168168  Cd Length: 265  Bit Score: 41.33  E-value: 1.62e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        18 GVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHSAKADG----AEARRFwfd 93
Cdd:PRK05674  15 GFATLWLSRADKNNAFNAQMIRELILALDQVQSDASLRFLLLRGRG-RHFSAGADLAWMQQSADLDYntnlDDAREL--- 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        94 eYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKLGLHAALTGA 173
Cdd:PRK05674  91 -AELMYNLYRLKIPTLAVVQGAAFGGALGLISCCDMAIGADDAQFCLSEVRIGLAPAVISPFVVKAIGERAARRYALTAE 169
                        170       180       190
                 ....*....|....*....|....*....|..
4HDT_A       174 PFSGADAIVMGFADHYVPHDKIDEFTRAVIAD 205
Cdd:PRK05674 170 RFDGRRARELGLLAESYPAAELEAQVEAWIAN 201
PRK09076 PRK09076
enoyl-CoA hydratase; Provisional
16-162 2.08e-04

enoyl-CoA hydratase; Provisional


Pssm-ID: 236373  Cd Length: 258  Bit Score: 41.06  E-value: 2.08e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        16 EGGVGLLTLNRPKAiNSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIYHSAKADGAE-ARRFWFDE 94
Cdd:PRK09076  10 DGHVAILTLNNPPA-NTWTADSLQALKQLVLELNADKDVYALVITGDGEKFFSAGADLNLFADGDKAVAREmARRFGEAF 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        95 YRLNAHIGrypkpyVSI-------M----------DGivmgggvgvgahgnvRVVTDTTKMAMPEVGIGFIPDVGGTYLL 157
Cdd:PRK09076  89 EALSAFRG------VSIaaingyaMggglecalacDI---------------RIAEEQAQMALPEASVGLLPCAGGTQNL 147

                 ....*
4HDT_A       158 SRAPG 162
Cdd:PRK09076 148 PWLVG 152
PRK08259 PRK08259
enoyl-CoA hydratase; Provisional
8-76 2.08e-04

enoyl-CoA hydratase; Provisional


Pssm-ID: 236205  Cd Length: 254  Bit Score: 41.04  E-value: 2.08e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
4HDT_A         8 NEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERgLCAGGDVVAI 76
Cdd:PRK08259   2 SMSVRVERNGPVTTVILNRPEVRNAVDGPTAAALADAFRAFDADDAASVAVLWGAGGT-FCAGADLKAV 69
dearomat_oah TIGR03200
6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase; Members of this protein family are ...
22-72 2.31e-04

6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase; Members of this protein family are 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase, a ring-hydrolyzing enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA.


Pssm-ID: 132244  Cd Length: 360  Bit Score: 41.43  E-value: 2.31e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
4HDT_A         22 LTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGD 72
Cdd:TIGR03200  41 IILDNPKQYNSYTTDMVKAIILAFRRASSDRDVVAVVFTAVGDKAFCTGGN 91
PRK07112 PRK07112
polyketide biosynthesis enoyl-CoA hydratase; Validated
11-88 4.35e-04

polyketide biosynthesis enoyl-CoA hydratase; Validated


Pssm-ID: 235938  Cd Length: 255  Bit Score: 40.05  E-value: 4.35e-04
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
4HDT_A        11 VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVraVLLTGAGERgLCAGGDVVAIYHSAKADGAEAR 88
Cdd:PRK07112   6 IRVRQQGDVCFLQLHRPEAQNTINDRLIAECMDVLDRCEHAATI--VVLEGLPEV-FCFGADFSAIAEKPDAGRADLI 80
PRK11423 PRK11423
methylmalonyl-CoA decarboxylase; Provisional
11-202 1.14e-03

methylmalonyl-CoA decarboxylase; Provisional


Pssm-ID: 236908  Cd Length: 261  Bit Score: 38.85  E-value: 1.14e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        11 VLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDsVRAVLL-TGAGERGLCAGGDVvaiyHSAKADGAEARR 89
Cdd:PRK11423   6 VNVVTINKIATITFNNPAKRNALSKVLIDDLMQALSDLNRPE-IRVVILrAPSGSKVWSAGHDI----HELPSGGRDPLS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        90 fWFDEYR-LNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGtylLSRAPGKLGLHA 168
Cdd:PRK11423  81 -YDDPLRqILRMIQKFPKPVIAMVEGSVWGGAFELIMSCDLIIAASTSTFAMTPANLGVPYNLSG---ILNFTNDAGFHI 156
                        170       180       190
                 ....*....|....*....|....*....|....*...
4HDT_A       169 A----LTGAPFSGADAIVMGFADHYVPHDKIDEFTRAV 202
Cdd:PRK11423 157 VkemfFTASPITAQRALAVGILNHVVEVEELEDFTLQM 194
PRK06495 PRK06495
enoyl-CoA hydratase; Provisional
11-311 1.92e-03

enoyl-CoA hydratase; Provisional


Pssm-ID: 168580  Cd Length: 257  Bit Score: 38.14  E-value: 1.92e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        11 VLVNVEGGVGLLTLNRPkAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHSAKADGAEARRF 90
Cdd:PRK06495   6 LKLEVSDHVAVVTLDNP-PVNALSRELRDELIAVFDEISERPDVRVVVLTGAG-KVFCAGADLKGRPDVIKGPGDLRAHN 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        91 WFDEYRLNAhIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIpdvGGTYLLSRapgklglhaal 170
Cdd:PRK06495  84 RRTRECFHA-IRECAKPVIAAVNGPALGAGLGLVASCDIIVASENAVFGLPEIDVGLA---GGGKHAMR----------- 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       171 tgapfsgadaivmgfadhYVPHdkidEFTRAVIADGVDAalaahaqepPASPLAeQRSWIDECYTGDTVadiiaalrahd 250
Cdd:PRK06495 149 ------------------LFGH----SLTRRMMLTGYRV---------PAAELY-RRGVIEACLPPEEL----------- 185
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
4HDT_A       251 APAAGEAADLIATRSPIALSVTLESVrRAAKLQSLEDTLRQEYRVSCASLKSHDLVEGIRA 311
Cdd:PRK06495 186 MPEAMEIAREIASKSPLATRLAKDAL-NTIENMSLRDGYRYEQDITAKLAKTEDAKEAQRA 245
PRK05617 PRK05617
3-hydroxyisobutyryl-CoA hydrolase; Provisional
8-341 1.78e-178

3-hydroxyisobutyryl-CoA hydrolase; Provisional


Pssm-ID: 235533 [Multi-domain]  Cd Length: 342  Bit Score: 501.66  E-value: 1.78e-178
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         8 NEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIYHSAKADGAEA 87
Cdd:PRK05617   2 EDEVLAEVEGGVGVITLNRPKALNALSLEMIRAIDAALDAWEDDDAVAAVVIEGAGERGFCAGGDIRALYEAARAGDPLA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        88 R-RFWFDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKLGL 166
Cdd:PRK05617  82 AdRFFREEYRLNALIARYPKPYIALMDGIVMGGGVGISAHGSHRIVTERTKMAMPETGIGFFPDVGGTYFLSRAPGALGT 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       167 HAALTGAPFSGADAIVMGFADHYVPHDKIDEFTRAVI-------ADGVDAALAAHAQEPPASPLAEQRSWIDECYTGDTV 239
Cdd:PRK05617 162 YLALTGARISAADALYAGLADHFVPSADLPALLDALIslrwdsgADVVDAALAAFATPAPASELAAQRAWIDECFAGDTV 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       240 ADIIAALRAHDAPAAGEAADLIATRSPIALSVTLESVRRAAKLqSLEDTLRQEYRVSCASLKSHDLVEGIRAQLVDKDRN 319
Cdd:PRK05617 242 EDIIAALEADGGEFAAKTADTLRSRSPTSLKVTLEQLRRARGL-TLEECLRRELRLALAMLRSPDFVEGVRAVLIDKDRN 320
                        330       340
                 ....*....|....*....|..
4HDT_A       320 PKWRPATLAEVTEADVEAYFAP 341
Cdd:PRK05617 321 PKWSPATLEDVTPEDVEAFFAP 342
PLN02874 PLN02874
3-hydroxyisobutyryl-CoA hydrolase-like protein
9-346 1.44e-76

3-hydroxyisobutyryl-CoA hydrolase-like protein


Pssm-ID: 178462 [Multi-domain]  Cd Length: 379  Bit Score: 242.78  E-value: 1.44e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         9 EDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYhsakaDGAEAR 88
Cdd:PLN02874  11 EVVLGEEKGRVRVITLNRPRQLNVISLSVVSLLAEFLEQWEKDDSVELIIIKGAG-RAFSAGGDLKMFY-----DGRESD 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        89 RFWFD----EYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKL 164
Cdd:PLN02874  85 DSCLEvvyrMYWLCYHIHTYKKTQVALVHGLVMGGGAGLMVPMKFRVVTEKTVFATPEASVGFHTDCGFSYILSRLPGHL 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       165 GLHAALTGAPFSGADAIVMGFADHYVPHDKIDEFTRAVI------ADGVDAALAAHAQEPPASP--LAEQRSWIDECYTG 236
Cdd:PLN02874 165 GEYLALTGARLNGKEMVACGLATHFVPSEKLPELEKRLLnlnsgdESAVQEAIEEFSKDVQADEdsILNKQSWINECFSK 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       237 DTVADIIAALRAHDAPAA----GEAADLIATRSPIALSVTLESVRRAAKlQSLEDTLRQEYRVSCASLK---SHDLVEGI 309
Cdd:PLN02874 245 DTVEEIIKAFESEASKTGnewiKETLKGLRRSSPTGLKITLRSIREGRK-QSLAECLKKEFRLTMNILRstvSDDVYEGI 323
                        330       340       350
                 ....*....|....*....|....*....|....*..
4HDT_A       310 RAQLVDKDRNPKWRPATLAEVTEADVEAYFAPVDPEL 346
Cdd:PLN02874 324 RALVIDKDNAPKWNPSTLDEVTDEKVDLVFQPFKARE 360
PLN02157 PLN02157
3-hydroxyisobutyryl-CoA hydrolase-like protein
4-346 4.55e-55

3-hydroxyisobutyryl-CoA hydrolase-like protein


Pssm-ID: 177817 [Multi-domain]  Cd Length: 401  Bit Score: 187.20  E-value: 4.55e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         4 VTAKNEDVLVNVEGGVGLLT--LNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGeRGLCAGGDVVAIYHSAK 81
Cdd:PLN02157  30 LTPEDLDYQVLVEGSGCSRTaiLNRPPALNALTTHMGYRLQKLYKNWEEDPNIGFVMMKGSG-RAFCAGGDIVSLYHLRK 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        82 ADGAEA-RRFWFDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRA 160
Cdd:PLN02157 109 RGSPDAiREFFSSLYSFIYLLGTYLKPHVAILNGVTMGGGTGVSIPGTFRVATDRTIFATPETIIGFHPDAGASFNLSHL 188
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       161 PGKLGLHAALTGAPFSGADAIVMGFADHYVPHDKI---DEFTRAVIADG---VDAAL--AAHAQEPPASPLAEQRSWIDE 232
Cdd:PLN02157 189 PGRLGEYLGLTGLKLSGAEMLACGLATHYIRSEEIpvmEEQLKKLLTDDpsvVESCLekCAEVAHPEKTGVIRRIDLLEK 268
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       233 CYTGDTVADIIAALRAhDAPAAGEAADLIATR-----SPIALSVTLESVRRaAKLQSLEDTLRQEYRVSCASL---KSHD 304
Cdd:PLN02157 269 CFSHDTVEEIIDSLEI-EAGRRKDTWCITTLRrlkesSPLSLKVALRSIRE-GRLQTLDQCLIREYRMSLQGLigpMSGN 346
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*
4HDT_A       305 LVEGIRAQLVDKDRNPKWRPATLAEVTEADVEAYF---APVDPEL 346
Cdd:PLN02157 347 FCEGVRARLIDKDEAPKWDPPSLEKVSEDMVDDYFcalTPTEPDL 391
FadB TIGR02437
fatty oxidation complex, alpha subunit FadB; Members represent alpha subunit of ...
15-286 4.09e-09

fatty oxidation complex, alpha subunit FadB; Members represent alpha subunit of multifunctional enzyme complex of the fatty acid degradation cycle. Activities include: enoyl-CoA hydratase (EC 4.2.1.17), dodecenoyl-CoA delta-isomerase activity (EC 5.3.3.8), 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35), 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3). A representative is E. coli FadB (SP:P21177). This model excludes the FadJ family represented by SP:P77399. [Fatty acid and phospholipid metabolism, Degradation]


Pssm-ID: 131490 [Multi-domain]  Cd Length: 714  Bit Score: 56.76  E-value: 4.09e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         15 VEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTgAGERGLCAGGDVVAIYHSAKADGAEARRFWFDE 94
Cdd:TIGR02437  13 LEDGIAELKFDAPGSVNKFDRATLASLDQALDAIKAQSSLKGVILT-SGKDAFIVGADITEFLGLFALPDAELIQWLLFA 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         95 YRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYllsRAPGKLGLHAAL---- 170
Cdd:TIGR02437  92 NSIFNKLEDLPVPTVAAINGIALGGGCECVLATDFRIADDTAKIGLPETKLGIMPGFGGTV---RLPRVIGADNALewia 168
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        171 TGAPFSGADAIVMGFADHYVPHDKIDEFTRAVIADGVDAALAAHAQ-EPPASPLaeQRSWIDECYTGDTVADIIAALRAH 249
Cdd:TIGR02437 169 SGKENRAEDALKVGAVDAVVTADKLGAAALQLLKDAINGKLDWKAKrQPKLEPL--KLSKIEAMMSFTTAKGMVAQVAGP 246
                         250       260       270
                  ....*....|....*....|....*....|....*..
4HDT_A        250 DAPAageaadliatrsPIALSVTLESVRRAAKLQSLE 286
Cdd:TIGR02437 247 HYPA------------PMTAVKTIEKAARFGRDKALE 271
FadJ TIGR02440
fatty oxidation complex, alpha subunit FadJ; Members represent alpha subunit of ...
16-193 6.75e-08

fatty oxidation complex, alpha subunit FadJ; Members represent alpha subunit of multifunctional enzyme complex of the fatty acid degradation cycle. Plays a minor role in aerobic beta-oxidation of fatty acids. FadJI complex is necessary for anaerobic growth on short-chain acids with nitrate as an electron acceptor. Activities include: enoyl-CoA hydratase (EC 4.2.1.17),3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35), 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3). A representative is E. coli FadJ (aka YfcX) (SP:P77399). This model excludes the FadB of TIGR02437 equivalog model. [Fatty acid and phospholipid metabolism, Degradation]


Pssm-ID: 131493 [Multi-domain]  Cd Length: 699  Bit Score: 52.90  E-value: 6.75e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         16 EGGVGLLTLNRP-KAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIYHSAKADgaEARRFWFDE 94
Cdd:TIGR02440   8 EDGIAILTIDVPgEKMNTLKAEFADQVSEILSQLKRDKSIRGLVLVSGKPDNFIAGADISMLAACQTAG--EAKALAQQG 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         95 YRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTD--TTKMAMPEVGIGFIPDVGGTYLLSRAPG-KLGLHAALT 171
Cdd:TIGR02440  86 QVLFAELEALPIPVVAAIHGACLGGGLELALACHSRVCSDddKTVLGLPEVQLGLLPGSGGTQRLPRLIGvSTALDMILT 165
                         170       180
                  ....*....|....*....|..
4HDT_A        172 GAPFSGADAIVMGFADHYVPHD 193
Cdd:TIGR02440 166 GKQLRAKQALKLGLVDDVVPQS 187
fadJ PRK11154
multifunctional fatty acid oxidation complex subunit alpha; Reviewed
16-193 7.94e-08

multifunctional fatty acid oxidation complex subunit alpha; Reviewed


Pssm-ID: 236864 [Multi-domain]  Cd Length: 708  Bit Score: 52.59  E-value: 7.94e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        16 EGGVGLLTLNRP-KAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIYHSAKAdgAEARRFWFDE 94
Cdd:PRK11154  13 EDNIAVITIDVPgEKMNTLKAEFAEQVRAILKQLREDKELKGVVFISGKPDNFIAGADINMLAACKTA--QEAEALARQG 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        95 YRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDT--TKMAMPEVGIGFIPDVGGTyllSRAPGKLGLHAA--- 169
Cdd:PRK11154  91 QQLFAEIEALPIPVVAAIHGACLGGGLELALACHYRVCTDDpkTVLGLPEVQLGLLPGSGGT---QRLPRLIGVSTAldm 167
                        170       180
                 ....*....|....*....|....*
4HDT_A       170 -LTGAPFSGADAIVMGFADHYVPHD 193
Cdd:PRK11154 168 iLTGKQLRAKQALKLGLVDDVVPHS 192
fadB PRK11730
multifunctional fatty acid oxidation complex subunit alpha; Reviewed
130-223 6.31e-07

multifunctional fatty acid oxidation complex subunit alpha; Reviewed


Pssm-ID: 183293 [Multi-domain]  Cd Length: 715  Bit Score: 49.86  E-value: 6.31e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A       130 RVVTDTTKMAMPEVGIGFIPDVGGTYLLSRApgkLGLHAAL----TGAPFSGADAIVMGFADHYVPHDKIDEFTRAVIAD 205
Cdd:PRK11730 127 RVASPDARIGLPETKLGIMPGFGGTVRLPRL---IGADNALewiaAGKDVRAEDALKVGAVDAVVAPEKLQEAALALLKQ 203
                         90
                 ....*....|....*....
4HDT_A       206 GVDAALAAHA-QEPPASPL 223
Cdd:PRK11730 204 AIAGKLDWKArRQPKLEPL 222
fa_ox_alpha_mit TIGR02441
fatty acid oxidation complex, alpha subunit, mitochondrial; Members represent alpha subunit of ...
1-190 1.20e-06

fatty acid oxidation complex, alpha subunit, mitochondrial; Members represent alpha subunit of mitochondrial multifunctional fatty acid degradation enzyme complex. Subunit activities include: enoyl-CoA hydratase (EC 4.2.1.17) _ 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35). Some characterization in human (SP:P40939), pig (SP:Q29554), and rat (SP:Q64428). The beta subunit has activity: acetyl-CoA C-acyltransferase (EC 2.3.1.16).


Pssm-ID: 131494 [Multi-domain]  Cd Length: 737  Bit Score: 48.68  E-value: 1.20e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A          1 GSMVTAKNEDVLVNVEGGVGLLTLNRPKA-INSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIyhS 79
Cdd:TIGR02441   5 TSAALMARTHRHYEVKGDVAVVKIDSPNSkVNTLSKELFAEFKEVMNELWTNEAIKSAVLISGKPGSFVAGADIQMI--A 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A         80 AKADGAEARRFWFDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTD--TTKMAMPEVGIGFIPDVGGTyll 157
Cdd:TIGR02441  83 ACKTAQEVTQLSQEGQEMFERIEKSQKPIVAAISGSCLGGGLELALACHYRIATKdrKTLLGLPEVMLGLLPGAGGT--- 159
                         170       180       190
                  ....*....|....*....|....*....|....*..
4HDT_A        158 SRAPGKLGLHAA----LTGAPFSGADAIVMGFADHYV 190
Cdd:TIGR02441 160 QRLPKLTGVPAAldmmLTGKKIRADRAKKMGIVDQLV 196
PLN02921 PLN02921
naphthoate synthase
15-111 3.44e-05

naphthoate synthase


Pssm-ID: 178509 [Multi-domain]  Cd Length: 327  Bit Score: 43.62  E-value: 3.44e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HDT_A        15 VEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDvvaiyHSAKADGAEARrfwFDE 94
Cdd:PLN02921  73 VGEGIAKITINRPERRNAFRPRTVKELQRAFNDARDDSSVGVIILTGKGTKAFCSGGD-----QAVRGKDGYVG---PDD 144
                         90       100
                 ....*....|....*....|...
4HDT_A        95 Y-RLNA-----HIGRYPKPYVSI 111
Cdd:PLN02921 145 AgRLNVldlqiQIRRLPKPVIAM 167
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH