NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|408536126|pdb|4HADD| ]
View 

Chain D, Crystal Structure Of Probable Oxidoreductase Protein From Rhizobium Etli Cfn 42

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
GFO_IDH_MocA pfam01408
Oxidoreductase family, NAD-binding Rossmann fold; This family of enzymes utilize NADP or NAD. ...
24-144 3.84e-31

Oxidoreductase family, NAD-binding Rossmann fold; This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.


:

Pssm-ID: 250596  Cd Length: 120  Bit Score: 115.00  E-value: 3.84e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD          24 LRFGIISTAKIGRDNVVPAIQDAENCVVTAIASRDLTRARE*ADRFSVPhAFGSYEE*LASDVIDAVYIPLPTSQHIEWS 103
Cdd:pfam01408   1 LRVGIVGAGKIGRRHLRALNESQDGAELVGILDPDPARAEAVAESFGVP-AYSDLEELLADPDIDAVSVATPPGLHFELA 79
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
4HADD         104 IKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEAY 144
Cdd:pfam01408  80 IAALQAGKHVLCEKPLATTVEEAKELVELAEKKGVVLSVGF 120
GFO_IDH_MocA_C pfam02894
Oxidoreductase family, C-terminal alpha/beta domain; This family of enzymes utilize NADP or ...
156-244 1.01e-05

Oxidoreductase family, C-terminal alpha/beta domain; This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.


:

Pssm-ID: 251601  Cd Length: 111  Bit Score: 43.30  E-value: 1.01e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD         156 RSLIDEGAIGSLRHVQGAFTYFNRDASN*RNIP--ELGGGGLPDIGVYPV*STRFSTGKEPLRIQANTERDPDFGTDIYS 233
Cdd:pfam02894   1 KELIENGVLGEVRLVSVDFYEDRAQRPSRWRWRrdKKGGGALGDLGIHDLDLLRWLFGEPPSVVAAAGSGQLAPAGEYED 80
                          90
                  ....*....|.
4HADD         234 SVKADFDDFEL 244
Cdd:pfam02894  81 AAFANLEFGSG 91
MviM COG0673
Predicted dehydrogenases and related proteins [General function prediction only]
24-350 2.79e-75

Predicted dehydrogenases and related proteins [General function prediction only]


:

Pssm-ID: 223745 [Multi-domain]  Cd Length: 342  Bit Score: 238.22  E-value: 2.79e-75
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD        24 LRFGIISTAKIGRDNVVPAIQDAENCV-VTAIASRDLTRARE*ADRFSVPHAFGSYEE*LASDVIDAVYIPLPTSQHIEW 102
Cdd:COG0673   4 IRVGIIGAGGIAGKAHLPALAALGGGLeLVAVVDRDPERAEAFAEEFGIAKAYTDLEELLADPDIDAVYIATPNALHAEL 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD       103 SIKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEAY*ITYSPVWQKVRSLIDEGAIGSLRHVQGAFTYFNRDAS 182
Cdd:COG0673  84 ALAALEAGKHVLCEKPLALTLEEAEELVELARKAGVKLMVGFNRRFDPAVQALKELIDSGALGEVVSVQASFSRDRPNPP 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD       183 N*---RNIPELGGGGLPDIGVYPV*STRFSTGK-EPLRIQANTERDP--DFGTDIYSSVKADFDD--FELSFYVSTQ*AN 254
Cdd:COG0673 164 PPpwwRFDRADGGGALLDLGIHDLDLLRFLLGSpEPVSVSAKARNSPpgEAGVDDSASAILRFENgvLAVSWASRTAAGG 243
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD       255 RQI*V-FHGTNGYIEVKSPFNANRWGPEEIELADRSHNESRIFRFQDSRQYRREVEAFARAVENGKEEVVTLENSKLNQK 333
Cdd:COG0673 244 YDVRLeVYGTKGSLEVDDGNPTGELLDGRIGLDVRGGDGELLLVPRRGNPYEGELEAFADAIRGGGEPLVSGEDALKALR 323
                       330
                ....*....|....*..
4HADD       334 VIDAIYRASEKDGWEAV 350
Cdd:COG0673 324 LAEAAYESAKEGRTVKL 340
 
Name Accession Description Interval E-value
GFO_IDH_MocA pfam01408
Oxidoreductase family, NAD-binding Rossmann fold; This family of enzymes utilize NADP or NAD. ...
24-144 3.84e-31

Oxidoreductase family, NAD-binding Rossmann fold; This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.


Pssm-ID: 250596  Cd Length: 120  Bit Score: 115.00  E-value: 3.84e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD          24 LRFGIISTAKIGRDNVVPAIQDAENCVVTAIASRDLTRARE*ADRFSVPhAFGSYEE*LASDVIDAVYIPLPTSQHIEWS 103
Cdd:pfam01408   1 LRVGIVGAGKIGRRHLRALNESQDGAELVGILDPDPARAEAVAESFGVP-AYSDLEELLADPDIDAVSVATPPGLHFELA 79
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
4HADD         104 IKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEAY 144
Cdd:pfam01408  80 IAALQAGKHVLCEKPLATTVEEAKELVELAEKKGVVLSVGF 120
GFO_IDH_MocA_C pfam02894
Oxidoreductase family, C-terminal alpha/beta domain; This family of enzymes utilize NADP or ...
156-244 1.01e-05

Oxidoreductase family, C-terminal alpha/beta domain; This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.


Pssm-ID: 251601  Cd Length: 111  Bit Score: 43.30  E-value: 1.01e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD         156 RSLIDEGAIGSLRHVQGAFTYFNRDASN*RNIP--ELGGGGLPDIGVYPV*STRFSTGKEPLRIQANTERDPDFGTDIYS 233
Cdd:pfam02894   1 KELIENGVLGEVRLVSVDFYEDRAQRPSRWRWRrdKKGGGALGDLGIHDLDLLRWLFGEPPSVVAAAGSGQLAPAGEYED 80
                          90
                  ....*....|.
4HADD         234 SVKADFDDFEL 244
Cdd:pfam02894  81 AAFANLEFGSG 91
MviM COG0673
Predicted dehydrogenases and related proteins [General function prediction only]
24-350 2.79e-75

Predicted dehydrogenases and related proteins [General function prediction only]


Pssm-ID: 223745 [Multi-domain]  Cd Length: 342  Bit Score: 238.22  E-value: 2.79e-75
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD        24 LRFGIISTAKIGRDNVVPAIQDAENCV-VTAIASRDLTRARE*ADRFSVPHAFGSYEE*LASDVIDAVYIPLPTSQHIEW 102
Cdd:COG0673   4 IRVGIIGAGGIAGKAHLPALAALGGGLeLVAVVDRDPERAEAFAEEFGIAKAYTDLEELLADPDIDAVYIATPNALHAEL 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD       103 SIKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEAY*ITYSPVWQKVRSLIDEGAIGSLRHVQGAFTYFNRDAS 182
Cdd:COG0673  84 ALAALEAGKHVLCEKPLALTLEEAEELVELARKAGVKLMVGFNRRFDPAVQALKELIDSGALGEVVSVQASFSRDRPNPP 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD       183 N*---RNIPELGGGGLPDIGVYPV*STRFSTGK-EPLRIQANTERDP--DFGTDIYSSVKADFDD--FELSFYVSTQ*AN 254
Cdd:COG0673 164 PPpwwRFDRADGGGALLDLGIHDLDLLRFLLGSpEPVSVSAKARNSPpgEAGVDDSASAILRFENgvLAVSWASRTAAGG 243
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD       255 RQI*V-FHGTNGYIEVKSPFNANRWGPEEIELADRSHNESRIFRFQDSRQYRREVEAFARAVENGKEEVVTLENSKLNQK 333
Cdd:COG0673 244 YDVRLeVYGTKGSLEVDDGNPTGELLDGRIGLDVRGGDGELLLVPRRGNPYEGELEAFADAIRGGGEPLVSGEDALKALR 323
                       330
                ....*....|....*..
4HADD       334 VIDAIYRASEKDGWEAV 350
Cdd:COG0673 324 LAEAAYESAKEGRTVKL 340
PRK11579 PRK11579
putative oxidoreductase; Provisional
41-177 1.62e-06

putative oxidoreductase; Provisional


Pssm-ID: 183212 [Multi-domain]  Cd Length: 346  Bit Score: 47.79  E-value: 1.62e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD         41 PAIQDAENCVVTAIASRDLTRARe*ADRFSVPHAfgSYEE*LASD-VIDAVYIPLPTSQHIEWSIKAADAGKHVVCEKPL 119
Cdd:PRK11579  22 PLIAGTPGLELAAVSSSDATKVK--ADWPTVTVV--SEPQHLFNDpNIDLIVIPTPNDTHFPLAKAALEAGKHVVVDKPF 97
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
4HADD        120 AL---KAGDIDAViaARDRNKVVvteay*ITYSPVWQK----VRSLIDEGAIGSLRHVQGAFTYF 177
Cdd:PRK11579  98 TVtlsQARELDAL--AKSAGRVL-----SVFHNRRWDSdfltLKALLAEGVLGEVAYFESHFDRF 155
 
Name Accession Description Interval E-value
GFO_IDH_MocA pfam01408
Oxidoreductase family, NAD-binding Rossmann fold; This family of enzymes utilize NADP or NAD. ...
24-144 3.84e-31

Oxidoreductase family, NAD-binding Rossmann fold; This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.


Pssm-ID: 250596  Cd Length: 120  Bit Score: 115.00  E-value: 3.84e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD          24 LRFGIISTAKIGRDNVVPAIQDAENCVVTAIASRDLTRARE*ADRFSVPhAFGSYEE*LASDVIDAVYIPLPTSQHIEWS 103
Cdd:pfam01408   1 LRVGIVGAGKIGRRHLRALNESQDGAELVGILDPDPARAEAVAESFGVP-AYSDLEELLADPDIDAVSVATPPGLHFELA 79
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
4HADD         104 IKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEAY 144
Cdd:pfam01408  80 IAALQAGKHVLCEKPLATTVEEAKELVELAEKKGVVLSVGF 120
GFO_IDH_MocA_C pfam02894
Oxidoreductase family, C-terminal alpha/beta domain; This family of enzymes utilize NADP or ...
156-244 1.01e-05

Oxidoreductase family, C-terminal alpha/beta domain; This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.


Pssm-ID: 251601  Cd Length: 111  Bit Score: 43.30  E-value: 1.01e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD         156 RSLIDEGAIGSLRHVQGAFTYFNRDASN*RNIP--ELGGGGLPDIGVYPV*STRFSTGKEPLRIQANTERDPDFGTDIYS 233
Cdd:pfam02894   1 KELIENGVLGEVRLVSVDFYEDRAQRPSRWRWRrdKKGGGALGDLGIHDLDLLRWLFGEPPSVVAAAGSGQLAPAGEYED 80
                          90
                  ....*....|.
4HADD         234 SVKADFDDFEL 244
Cdd:pfam02894  81 AAFANLEFGSG 91
MviM COG0673
Predicted dehydrogenases and related proteins [General function prediction only]
24-350 2.79e-75

Predicted dehydrogenases and related proteins [General function prediction only]


Pssm-ID: 223745 [Multi-domain]  Cd Length: 342  Bit Score: 238.22  E-value: 2.79e-75
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD        24 LRFGIISTAKIGRDNVVPAIQDAENCV-VTAIASRDLTRARE*ADRFSVPHAFGSYEE*LASDVIDAVYIPLPTSQHIEW 102
Cdd:COG0673   4 IRVGIIGAGGIAGKAHLPALAALGGGLeLVAVVDRDPERAEAFAEEFGIAKAYTDLEELLADPDIDAVYIATPNALHAEL 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD       103 SIKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEAY*ITYSPVWQKVRSLIDEGAIGSLRHVQGAFTYFNRDAS 182
Cdd:COG0673  84 ALAALEAGKHVLCEKPLALTLEEAEELVELARKAGVKLMVGFNRRFDPAVQALKELIDSGALGEVVSVQASFSRDRPNPP 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD       183 N*---RNIPELGGGGLPDIGVYPV*STRFSTGK-EPLRIQANTERDP--DFGTDIYSSVKADFDD--FELSFYVSTQ*AN 254
Cdd:COG0673 164 PPpwwRFDRADGGGALLDLGIHDLDLLRFLLGSpEPVSVSAKARNSPpgEAGVDDSASAILRFENgvLAVSWASRTAAGG 243
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD       255 RQI*V-FHGTNGYIEVKSPFNANRWGPEEIELADRSHNESRIFRFQDSRQYRREVEAFARAVENGKEEVVTLENSKLNQK 333
Cdd:COG0673 244 YDVRLeVYGTKGSLEVDDGNPTGELLDGRIGLDVRGGDGELLLVPRRGNPYEGELEAFADAIRGGGEPLVSGEDALKALR 323
                       330
                ....*....|....*..
4HADD       334 VIDAIYRASEKDGWEAV 350
Cdd:COG0673 324 LAEAAYESAKEGRTVKL 340
PRK11579 PRK11579
putative oxidoreductase; Provisional
41-177 1.62e-06

putative oxidoreductase; Provisional


Pssm-ID: 183212 [Multi-domain]  Cd Length: 346  Bit Score: 47.79  E-value: 1.62e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD         41 PAIQDAENCVVTAIASRDLTRARe*ADRFSVPHAfgSYEE*LASD-VIDAVYIPLPTSQHIEWSIKAADAGKHVVCEKPL 119
Cdd:PRK11579  22 PLIAGTPGLELAAVSSSDATKVK--ADWPTVTVV--SEPQHLFNDpNIDLIVIPTPNDTHFPLAKAALEAGKHVVVDKPF 97
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
4HADD        120 AL---KAGDIDAViaARDRNKVVvteay*ITYSPVWQK----VRSLIDEGAIGSLRHVQGAFTYF 177
Cdd:PRK11579  98 TVtlsQARELDAL--AKSAGRVL-----SVFHNRRWDSdfltLKALLAEGVLGEVAYFESHFDRF 155
PRK10206 PRK10206
putative oxidoreductase; Provisional
64-191 2.48e-03

putative oxidoreductase; Provisional


Pssm-ID: 182305 [Multi-domain]  Cd Length: 344  Bit Score: 37.88  E-value: 2.48e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HADD         64 E*ADRFSVPHAFGSYEE*LASDVIDAVYIPLPTSQHIEWSIKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEA 143
Cdd:PRK10206  42 EQAPIYSHIHFTSDLDEVLNDPDVKLVVVCTHADSHFEYAKRALEAGKNVLVEKPFTPTLAEAKELFALAKSKGLTVTPY 121
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
4HADD        144 Y*ITYSPVWQKVRSLIDEGAIGSLRHVQGAFTYFNRDASN*RNIPELG 191
Cdd:PRK10206 122 QNRRFDSCFLTAKKAIESGKLGEIVEVESHFDYYRPVAETKPGLPQDG 169
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH