NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|220702302|pdb|2ZV4X| ]
View 

Chain X, The Structure Of Rat Liver Vault At 3.5 Angstrom Resolution

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MVP_shoulder cd08825
Shoulder domain of the major vault protein; The major vault protein is the major polypeptide ...
509-670 4.79e-83

Shoulder domain of the major vault protein; The major vault protein is the major polypeptide component of a large cellular ribonuclear protein complex found in the cytoplasm of eukaryotic cells. Its shoulder domain appears to be a homolog of the SPFH core domain. Vault proteins may be involved in detoxification processes, and have been associated with the multi-drug resistance (MDR) phenotype in malignancies. Presumably they play a role in transport processes.


:

Pssm-ID: 259807  Cd Length: 151  Bit Score: 264.47  E-value: 4.79e-83
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X       509 HARRALCLLLGPDFFTDVITIETADHARLQLQLAYNWHFELkNRNDPAEAAKLFSVPDFVGDACKAIASRVRGAVASVTF 588
Cdd:cd08825   1 NQIKALCLLLGPDFMTDIITVETADHARLQLQLAYNWHFDV-DDKKPEEAAKLFSVPDFIGDACKAIASRIRGAVASVTF 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X       589 DDFHKNSARIIRMAVFGFemsEDTGPDgtllpkaRDQAVFPQNGLVVSSVDVQSVEPVDQRTRDALQRSVQLAIEITTNS 668
Cdd:cd08825  80 DDFHKNSARIIRSAVFGD---DEKGEV-------RDELRFPANNLVITNVDIQSVEPVDQRTRDSLQKSVQLAIEITTNS 149

                ..
2ZV4X       669 QE 670
Cdd:cd08825 150 QE 151
Vault pfam01505
Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein ...
112-153 9.69e-14

Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein particle of approximately 13 mDa of unknown function. This family corresponds to a repeat found in the amino terminal half of the major vault protein.


:

Pssm-ID: 201831  Cd Length: 43  Bit Score: 67.19  E-value: 9.69e-14
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
2ZV4X         112 LQVVLPNTALHLKALLDFEDKNGDKVMAGDEWLFEGPGTYIP 153
Cdd:pfam01505   1 AHVLDENEALLLRALGPFTDRDGVKRKAGEEWLVRGPGTYIP 42
Vault pfam01505
Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein ...
165-206 1.11e-11

Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein particle of approximately 13 mDa of unknown function. This family corresponds to a repeat found in the amino terminal half of the major vault protein.


:

Pssm-ID: 201831  Cd Length: 43  Bit Score: 61.41  E-value: 1.11e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
2ZV4X         165 ATVIKQNQALRLRARKECFDREGKGRVTGEEWLVRSVGAYLP 206
Cdd:pfam01505   1 AHVLDENEALLLRALGPFTDRDGVKRKAGEEWLVRGPGTYIP 42
Vault pfam01505
Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein ...
218-262 9.69e-11

Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein particle of approximately 13 mDa of unknown function. This family corresponds to a repeat found in the amino terminal half of the major vault protein.


:

Pssm-ID: 201831  Cd Length: 43  Bit Score: 58.71  E-value: 9.69e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
2ZV4X         218 AVILTEKTALHLRALQNFRDLRGVLHRTGEEWLVTVqdTEAHVPD 262
Cdd:pfam01505   1 AHVLDENEALLLRALGPFTDRDGVKRKAGEEWLVRG--PGTYIPP 43
Vault pfam01505
Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein ...
323-367 1.74e-08

Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein particle of approximately 13 mDa of unknown function. This family corresponds to a repeat found in the amino terminal half of the major vault protein.


:

Pssm-ID: 201831  Cd Length: 43  Bit Score: 52.17  E-value: 1.74e-08
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
2ZV4X         323 VYVLSEQQGLLLKALQPLEEgesEEKVSHQAGDCWLIRGPLEYVP 367
Cdd:pfam01505   1 AHVLDENEALLLRALGPFTD---RDGVKRKAGEEWLVRGPGTYIP 42
PTZ00491 PTZ00491
major vault protein; Provisional
4-850 0e+00

major vault protein; Provisional


:

Pssm-ID: 240439 [Multi-domain]  Cd Length: 850  Bit Score: 1165.17  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X          4 EEAIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPVRMVTVPPRHYCIVANPVSRDTQSSVLFDITGQVRL 83
Cdd:PTZ00491   3 TESVIRLKPYEYIHVLDNNTNVTRLIVGPQTFTRQDHERVLHPPQPMVVVPPRHYCIVENPHVRDPDGSPVKDAYGQVKV 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X         84 RHADQEIRLAQDPFPLYPGEVLEKDITPLQVVLPNTALHLKALLDFEDKNGDKVMAGDEWLFEGPGTYIPQKEVEVVEII 163
Cdd:PTZ00491  83 RHGEREIRFSQDPFPLYPGEKLVTQVEPLKVLPANEALRVRALRDFTVEDGVRRVAGEEWLFKGPGTYYPRVEERIVEEV 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        164 QATVIKQNQALRLRARKECFDREGKGRVTGEEWLVRSVGAYLPAVFEEVLDLVDAVILTEKTALHLRALQNFRDLRGVLH 243
Cdd:PTZ00491 163 KAVLIKPNQALKLRALETFTDRDGVPRVAGEEWLVRTPGAYLPGVFEEVVGVVKGIVLSDKEALHLRALRTFTDVYGGIA 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        244 R-TGEEWLVTVQDTEAHVPDVYEEVLGVVPITTLGPRHYCVILDPMGPDGKNQLGQKRVVKGEKSFFLQPGERLER-GIQ 321
Cdd:PTZ00491 243 RkAGEEWLVTHEDCPTHIPDVYEKLVATVNATHLSARQYCVILNPVGDDGHNRFGAKELRKGECSFFLQPGESLEGdGIQ 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        322 DVYVLSEQQGLLLKALQPLEEgesEEKVSHQAGDCWLIRGPLEYVPSAKVEVVEERQAIPLDQNEGIYVQDVKTGKVRAV 401
Cdd:PTZ00491 323 DAYVLGEDEALLLRALETFTD---EDGVEREPGDRWLVHGPCEYIPPVLVEVVERRRRIPLDENEGIYVRNITTGEVRAV 399
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        402 IGSTYMLTQDEVLWEKELPSGVEELLN--LGHDPLADRGQKGTAKPLQPSAP-----RNKTRVVSYRVPHNAAVQVYDYR 474
Cdd:PTZ00491 400 HGKPYMLGAHEELWEKPLPPNVEELLAqpRSSMAYSERSGQASGKVPYEENPgfeshRDKHRVVTYKVPHNAAVQLYDYK 479
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        475 AKRARVVFGPELVTLDPEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQLQLAYNWHFELkNRND 554
Cdd:PTZ00491 480 TKKSRVVFGPDLVMLEPDEEFTVLSLSGGKPKVPNQIHSLHLFLGPDFMTDVIHVETSDHARLALQLSYNWYFDV-TDGN 558
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        555 PAEAAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIRMAVFGfeMSEDTGpdgtllpKARDQAVFPQNGLV 634
Cdd:PTZ00491 559 PEDAQKCFSVPDFVGDACKTIASRVRAAVASEPFDEFHKNSAKIIRQAVFG--SNDETG-------EVRDSLRFPANNLV 629
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        635 VSSVDVQSVEPVDQRTRDALQRSVQLAIEITTNSQEAAAKHEAQRLEQEARGRLERQKILDQSEAEKARKELLELEAMSM 714
Cdd:PTZ00491 630 ITNVDVQSVEPVDERTRDSLQKSVQLAIEITTKSQEAAARHQAELLEQEARGRLERQKMHDKAKAEEQRTKLLELQAESA 709
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        715 AVESTGNAKAEAESRAEAARIEGEGSVLQAKLKAQALAIETEAELERVKKVREMELIYARAQLELEVSKAQQLANVEAKK 794
Cdd:PTZ00491 710 AVESSGQSRAEALAEAEARLIEAEAEVEQAELRAKALRIEAEAELEKLRKRQELELEYEQAQNELEIAKAKELADIEATK 789
                        810       820       830       840       850
                 ....*....|....*....|....*....|....*....|....*....|....*.
2ZV4X        795 FKEMTEALGPGTIRDLAVAGPEMQVKLLQSLGLKSTLITDGSSPINLFSTAFGLLG 850
Cdd:PTZ00491 790 FERIVEALGRETLIAIARAGPELQAKLLGGLGLKGYLVTDGKSPINLFNTANGLIG 845
 
Name Accession Description Interval E-value
MVP_shoulder cd08825
Shoulder domain of the major vault protein; The major vault protein is the major polypeptide ...
509-670 4.79e-83

Shoulder domain of the major vault protein; The major vault protein is the major polypeptide component of a large cellular ribonuclear protein complex found in the cytoplasm of eukaryotic cells. Its shoulder domain appears to be a homolog of the SPFH core domain. Vault proteins may be involved in detoxification processes, and have been associated with the multi-drug resistance (MDR) phenotype in malignancies. Presumably they play a role in transport processes.


Pssm-ID: 259807  Cd Length: 151  Bit Score: 264.47  E-value: 4.79e-83
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X       509 HARRALCLLLGPDFFTDVITIETADHARLQLQLAYNWHFELkNRNDPAEAAKLFSVPDFVGDACKAIASRVRGAVASVTF 588
Cdd:cd08825   1 NQIKALCLLLGPDFMTDIITVETADHARLQLQLAYNWHFDV-DDKKPEEAAKLFSVPDFIGDACKAIASRIRGAVASVTF 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X       589 DDFHKNSARIIRMAVFGFemsEDTGPDgtllpkaRDQAVFPQNGLVVSSVDVQSVEPVDQRTRDALQRSVQLAIEITTNS 668
Cdd:cd08825  80 DDFHKNSARIIRSAVFGD---DEKGEV-------RDELRFPANNLVITNVDIQSVEPVDQRTRDSLQKSVQLAIEITTNS 149

                ..
2ZV4X       669 QE 670
Cdd:cd08825 150 QE 151
MVP_shoulder pfam11978
Shoulder domain; This domain is found in the Major Vault Protein and has been called the ...
519-647 6.40e-57

Shoulder domain; This domain is found in the Major Vault Protein and has been called the shoulder domain. This family includes two bacterial proteins. This suggests that some bacteria may possess vault particles.


Pssm-ID: 204801  Cd Length: 118  Bit Score: 190.96  E-value: 6.40e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X         519 GPDFFTDVITIETADHARLQLQLAYNWHFELkNRNDPAEAAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARI 598
Cdd:pfam11978   1 GPDFMTDIIEVETSDHARLQLQLSYNWHFDV-DRDDPADAQKWFSVPDFVGDACKAIASRIRGAVASVTFDDFHKNSAKI 79
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
2ZV4X         599 IRMAVFGFEMSEDTgpdgtllpkaRDQAVFPQNGLVVSSVDVQSVEPVD 647
Cdd:pfam11978  80 IRQAVFGADEKGET----------RDGLRFEANGLVITSVDVQSVEPVD 118
Vault pfam01505
Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein ...
112-153 9.69e-14

Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein particle of approximately 13 mDa of unknown function. This family corresponds to a repeat found in the amino terminal half of the major vault protein.


Pssm-ID: 201831  Cd Length: 43  Bit Score: 67.19  E-value: 9.69e-14
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
2ZV4X         112 LQVVLPNTALHLKALLDFEDKNGDKVMAGDEWLFEGPGTYIP 153
Cdd:pfam01505   1 AHVLDENEALLLRALGPFTDRDGVKRKAGEEWLVRGPGTYIP 42
Vault pfam01505
Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein ...
165-206 1.11e-11

Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein particle of approximately 13 mDa of unknown function. This family corresponds to a repeat found in the amino terminal half of the major vault protein.


Pssm-ID: 201831  Cd Length: 43  Bit Score: 61.41  E-value: 1.11e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
2ZV4X         165 ATVIKQNQALRLRARKECFDREGKGRVTGEEWLVRSVGAYLP 206
Cdd:pfam01505   1 AHVLDENEALLLRALGPFTDRDGVKRKAGEEWLVRGPGTYIP 42
Vault pfam01505
Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein ...
218-262 9.69e-11

Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein particle of approximately 13 mDa of unknown function. This family corresponds to a repeat found in the amino terminal half of the major vault protein.


Pssm-ID: 201831  Cd Length: 43  Bit Score: 58.71  E-value: 9.69e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
2ZV4X         218 AVILTEKTALHLRALQNFRDLRGVLHRTGEEWLVTVqdTEAHVPD 262
Cdd:pfam01505   1 AHVLDENEALLLRALGPFTDRDGVKRKAGEEWLVRG--PGTYIPP 43
Vault pfam01505
Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein ...
323-367 1.74e-08

Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein particle of approximately 13 mDa of unknown function. This family corresponds to a repeat found in the amino terminal half of the major vault protein.


Pssm-ID: 201831  Cd Length: 43  Bit Score: 52.17  E-value: 1.74e-08
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
2ZV4X         323 VYVLSEQQGLLLKALQPLEEgesEEKVSHQAGDCWLIRGPLEYVP 367
Cdd:pfam01505   1 AHVLDENEALLLRALGPFTD---RDGVKRKAGEEWLVRGPGTYIP 42
PTZ00491 PTZ00491
major vault protein; Provisional
4-850 0e+00

major vault protein; Provisional


Pssm-ID: 240439 [Multi-domain]  Cd Length: 850  Bit Score: 1165.17  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X          4 EEAIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPVRMVTVPPRHYCIVANPVSRDTQSSVLFDITGQVRL 83
Cdd:PTZ00491   3 TESVIRLKPYEYIHVLDNNTNVTRLIVGPQTFTRQDHERVLHPPQPMVVVPPRHYCIVENPHVRDPDGSPVKDAYGQVKV 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X         84 RHADQEIRLAQDPFPLYPGEVLEKDITPLQVVLPNTALHLKALLDFEDKNGDKVMAGDEWLFEGPGTYIPQKEVEVVEII 163
Cdd:PTZ00491  83 RHGEREIRFSQDPFPLYPGEKLVTQVEPLKVLPANEALRVRALRDFTVEDGVRRVAGEEWLFKGPGTYYPRVEERIVEEV 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        164 QATVIKQNQALRLRARKECFDREGKGRVTGEEWLVRSVGAYLPAVFEEVLDLVDAVILTEKTALHLRALQNFRDLRGVLH 243
Cdd:PTZ00491 163 KAVLIKPNQALKLRALETFTDRDGVPRVAGEEWLVRTPGAYLPGVFEEVVGVVKGIVLSDKEALHLRALRTFTDVYGGIA 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        244 R-TGEEWLVTVQDTEAHVPDVYEEVLGVVPITTLGPRHYCVILDPMGPDGKNQLGQKRVVKGEKSFFLQPGERLER-GIQ 321
Cdd:PTZ00491 243 RkAGEEWLVTHEDCPTHIPDVYEKLVATVNATHLSARQYCVILNPVGDDGHNRFGAKELRKGECSFFLQPGESLEGdGIQ 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        322 DVYVLSEQQGLLLKALQPLEEgesEEKVSHQAGDCWLIRGPLEYVPSAKVEVVEERQAIPLDQNEGIYVQDVKTGKVRAV 401
Cdd:PTZ00491 323 DAYVLGEDEALLLRALETFTD---EDGVEREPGDRWLVHGPCEYIPPVLVEVVERRRRIPLDENEGIYVRNITTGEVRAV 399
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        402 IGSTYMLTQDEVLWEKELPSGVEELLN--LGHDPLADRGQKGTAKPLQPSAP-----RNKTRVVSYRVPHNAAVQVYDYR 474
Cdd:PTZ00491 400 HGKPYMLGAHEELWEKPLPPNVEELLAqpRSSMAYSERSGQASGKVPYEENPgfeshRDKHRVVTYKVPHNAAVQLYDYK 479
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        475 AKRARVVFGPELVTLDPEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQLQLAYNWHFELkNRND 554
Cdd:PTZ00491 480 TKKSRVVFGPDLVMLEPDEEFTVLSLSGGKPKVPNQIHSLHLFLGPDFMTDVIHVETSDHARLALQLSYNWYFDV-TDGN 558
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        555 PAEAAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIRMAVFGfeMSEDTGpdgtllpKARDQAVFPQNGLV 634
Cdd:PTZ00491 559 PEDAQKCFSVPDFVGDACKTIASRVRAAVASEPFDEFHKNSAKIIRQAVFG--SNDETG-------EVRDSLRFPANNLV 629
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        635 VSSVDVQSVEPVDQRTRDALQRSVQLAIEITTNSQEAAAKHEAQRLEQEARGRLERQKILDQSEAEKARKELLELEAMSM 714
Cdd:PTZ00491 630 ITNVDVQSVEPVDERTRDSLQKSVQLAIEITTKSQEAAARHQAELLEQEARGRLERQKMHDKAKAEEQRTKLLELQAESA 709
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        715 AVESTGNAKAEAESRAEAARIEGEGSVLQAKLKAQALAIETEAELERVKKVREMELIYARAQLELEVSKAQQLANVEAKK 794
Cdd:PTZ00491 710 AVESSGQSRAEALAEAEARLIEAEAEVEQAELRAKALRIEAEAELEKLRKRQELELEYEQAQNELEIAKAKELADIEATK 789
                        810       820       830       840       850
                 ....*....|....*....|....*....|....*....|....*....|....*.
2ZV4X        795 FKEMTEALGPGTIRDLAVAGPEMQVKLLQSLGLKSTLITDGSSPINLFSTAFGLLG 850
Cdd:PTZ00491 790 FERIVEALGRETLIAIARAGPELQAKLLGGLGLKGYLVTDGKSPINLFNTANGLIG 845
 
Name Accession Description Interval E-value
MVP_shoulder cd08825
Shoulder domain of the major vault protein; The major vault protein is the major polypeptide ...
509-670 4.79e-83

Shoulder domain of the major vault protein; The major vault protein is the major polypeptide component of a large cellular ribonuclear protein complex found in the cytoplasm of eukaryotic cells. Its shoulder domain appears to be a homolog of the SPFH core domain. Vault proteins may be involved in detoxification processes, and have been associated with the multi-drug resistance (MDR) phenotype in malignancies. Presumably they play a role in transport processes.


Pssm-ID: 259807  Cd Length: 151  Bit Score: 264.47  E-value: 4.79e-83
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X       509 HARRALCLLLGPDFFTDVITIETADHARLQLQLAYNWHFELkNRNDPAEAAKLFSVPDFVGDACKAIASRVRGAVASVTF 588
Cdd:cd08825   1 NQIKALCLLLGPDFMTDIITVETADHARLQLQLAYNWHFDV-DDKKPEEAAKLFSVPDFIGDACKAIASRIRGAVASVTF 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X       589 DDFHKNSARIIRMAVFGFemsEDTGPDgtllpkaRDQAVFPQNGLVVSSVDVQSVEPVDQRTRDALQRSVQLAIEITTNS 668
Cdd:cd08825  80 DDFHKNSARIIRSAVFGD---DEKGEV-------RDELRFPANNLVITNVDIQSVEPVDQRTRDSLQKSVQLAIEITTNS 149

                ..
2ZV4X       669 QE 670
Cdd:cd08825 150 QE 151
MVP_shoulder pfam11978
Shoulder domain; This domain is found in the Major Vault Protein and has been called the ...
519-647 6.40e-57

Shoulder domain; This domain is found in the Major Vault Protein and has been called the shoulder domain. This family includes two bacterial proteins. This suggests that some bacteria may possess vault particles.


Pssm-ID: 204801  Cd Length: 118  Bit Score: 190.96  E-value: 6.40e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X         519 GPDFFTDVITIETADHARLQLQLAYNWHFELkNRNDPAEAAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARI 598
Cdd:pfam11978   1 GPDFMTDIIEVETSDHARLQLQLSYNWHFDV-DRDDPADAQKWFSVPDFVGDACKAIASRIRGAVASVTFDDFHKNSAKI 79
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
2ZV4X         599 IRMAVFGFEMSEDTgpdgtllpkaRDQAVFPQNGLVVSSVDVQSVEPVD 647
Cdd:pfam11978  80 IRQAVFGADEKGET----------RDGLRFEANGLVITSVDVQSVEPVD 118
Vault pfam01505
Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein ...
112-153 9.69e-14

Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein particle of approximately 13 mDa of unknown function. This family corresponds to a repeat found in the amino terminal half of the major vault protein.


Pssm-ID: 201831  Cd Length: 43  Bit Score: 67.19  E-value: 9.69e-14
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
2ZV4X         112 LQVVLPNTALHLKALLDFEDKNGDKVMAGDEWLFEGPGTYIP 153
Cdd:pfam01505   1 AHVLDENEALLLRALGPFTDRDGVKRKAGEEWLVRGPGTYIP 42
Vault pfam01505
Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein ...
165-206 1.11e-11

Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein particle of approximately 13 mDa of unknown function. This family corresponds to a repeat found in the amino terminal half of the major vault protein.


Pssm-ID: 201831  Cd Length: 43  Bit Score: 61.41  E-value: 1.11e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
2ZV4X         165 ATVIKQNQALRLRARKECFDREGKGRVTGEEWLVRSVGAYLP 206
Cdd:pfam01505   1 AHVLDENEALLLRALGPFTDRDGVKRKAGEEWLVRGPGTYIP 42
SPFH_like cd02106
core domain of the SPFH (stomatin, prohibitin, flotillin, and HflK/C) superfamily; This model ...
525-614 5.31e-11

core domain of the SPFH (stomatin, prohibitin, flotillin, and HflK/C) superfamily; This model summarizes proteins similar to stomatin, prohibitin, flotillin, HflK/C (SPFH) and podocin. The conserved domain common to the SPFH superfamily has also been referred to as the Band 7 domain. Many superfamily members are associated with lipid rafts. Individual proteins of the SPFH superfamily may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons, and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease, and in cancer invasion and metastasis. Mutations in the podocin gene give rise to autosomal recessive steroid resistant nephritic syndrome.


Pssm-ID: 259797  Cd Length: 110  Bit Score: 60.84  E-value: 5.31e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X       525 DVITIETADHARLQLQLAYNWHFELKNRnDPAEAAKLFsVPDFVGDACKAIASRVRGAVASVTFDDFHKNsARIIRMAVF 604
Cdd:cd02106   8 RVEPVGTADGVPVAVDLVVQFRITDYNA-LPAFYLVDF-VKDIKADIRRKIADVLRAAIGRMTLDQIISG-RDEIAKAVK 84
                        90
                ....*....|
2ZV4X       605 GFEMSEDTGP 614
Cdd:cd02106  85 EDLEEDLENF 94
Vault pfam01505
Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein ...
218-262 9.69e-11

Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein particle of approximately 13 mDa of unknown function. This family corresponds to a repeat found in the amino terminal half of the major vault protein.


Pssm-ID: 201831  Cd Length: 43  Bit Score: 58.71  E-value: 9.69e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
2ZV4X         218 AVILTEKTALHLRALQNFRDLRGVLHRTGEEWLVTVqdTEAHVPD 262
Cdd:pfam01505   1 AHVLDENEALLLRALGPFTDRDGVKRKAGEEWLVRG--PGTYIPP 43
Vault pfam01505
Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein ...
323-367 1.74e-08

Major Vault Protein repeat; The vault is a ubiquitous and highly conserved ribonucleoprotein particle of approximately 13 mDa of unknown function. This family corresponds to a repeat found in the amino terminal half of the major vault protein.


Pssm-ID: 201831  Cd Length: 43  Bit Score: 52.17  E-value: 1.74e-08
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
2ZV4X         323 VYVLSEQQGLLLKALQPLEEgesEEKVSHQAGDCWLIRGPLEYVP 367
Cdd:pfam01505   1 AHVLDENEALLLRALGPFTD---RDGVKRKAGEEWLVRGPGTYIP 42
PTZ00491 PTZ00491
major vault protein; Provisional
4-850 0e+00

major vault protein; Provisional


Pssm-ID: 240439 [Multi-domain]  Cd Length: 850  Bit Score: 1165.17  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X          4 EEAIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPVRMVTVPPRHYCIVANPVSRDTQSSVLFDITGQVRL 83
Cdd:PTZ00491   3 TESVIRLKPYEYIHVLDNNTNVTRLIVGPQTFTRQDHERVLHPPQPMVVVPPRHYCIVENPHVRDPDGSPVKDAYGQVKV 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X         84 RHADQEIRLAQDPFPLYPGEVLEKDITPLQVVLPNTALHLKALLDFEDKNGDKVMAGDEWLFEGPGTYIPQKEVEVVEII 163
Cdd:PTZ00491  83 RHGEREIRFSQDPFPLYPGEKLVTQVEPLKVLPANEALRVRALRDFTVEDGVRRVAGEEWLFKGPGTYYPRVEERIVEEV 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        164 QATVIKQNQALRLRARKECFDREGKGRVTGEEWLVRSVGAYLPAVFEEVLDLVDAVILTEKTALHLRALQNFRDLRGVLH 243
Cdd:PTZ00491 163 KAVLIKPNQALKLRALETFTDRDGVPRVAGEEWLVRTPGAYLPGVFEEVVGVVKGIVLSDKEALHLRALRTFTDVYGGIA 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        244 R-TGEEWLVTVQDTEAHVPDVYEEVLGVVPITTLGPRHYCVILDPMGPDGKNQLGQKRVVKGEKSFFLQPGERLER-GIQ 321
Cdd:PTZ00491 243 RkAGEEWLVTHEDCPTHIPDVYEKLVATVNATHLSARQYCVILNPVGDDGHNRFGAKELRKGECSFFLQPGESLEGdGIQ 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        322 DVYVLSEQQGLLLKALQPLEEgesEEKVSHQAGDCWLIRGPLEYVPSAKVEVVEERQAIPLDQNEGIYVQDVKTGKVRAV 401
Cdd:PTZ00491 323 DAYVLGEDEALLLRALETFTD---EDGVEREPGDRWLVHGPCEYIPPVLVEVVERRRRIPLDENEGIYVRNITTGEVRAV 399
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        402 IGSTYMLTQDEVLWEKELPSGVEELLN--LGHDPLADRGQKGTAKPLQPSAP-----RNKTRVVSYRVPHNAAVQVYDYR 474
Cdd:PTZ00491 400 HGKPYMLGAHEELWEKPLPPNVEELLAqpRSSMAYSERSGQASGKVPYEENPgfeshRDKHRVVTYKVPHNAAVQLYDYK 479
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        475 AKRARVVFGPELVTLDPEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQLQLAYNWHFELkNRND 554
Cdd:PTZ00491 480 TKKSRVVFGPDLVMLEPDEEFTVLSLSGGKPKVPNQIHSLHLFLGPDFMTDVIHVETSDHARLALQLSYNWYFDV-TDGN 558
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        555 PAEAAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIRMAVFGfeMSEDTGpdgtllpKARDQAVFPQNGLV 634
Cdd:PTZ00491 559 PEDAQKCFSVPDFVGDACKTIASRVRAAVASEPFDEFHKNSAKIIRQAVFG--SNDETG-------EVRDSLRFPANNLV 629
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        635 VSSVDVQSVEPVDQRTRDALQRSVQLAIEITTNSQEAAAKHEAQRLEQEARGRLERQKILDQSEAEKARKELLELEAMSM 714
Cdd:PTZ00491 630 ITNVDVQSVEPVDERTRDSLQKSVQLAIEITTKSQEAAARHQAELLEQEARGRLERQKMHDKAKAEEQRTKLLELQAESA 709
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZV4X        715 AVESTGNAKAEAESRAEAARIEGEGSVLQAKLKAQALAIETEAELERVKKVREMELIYARAQLELEVSKAQQLANVEAKK 794
Cdd:PTZ00491 710 AVESSGQSRAEALAEAEARLIEAEAEVEQAELRAKALRIEAEAELEKLRKRQELELEYEQAQNELEIAKAKELADIEATK 789
                        810       820       830       840       850
                 ....*....|....*....|....*....|....*....|....*....|....*.
2ZV4X        795 FKEMTEALGPGTIRDLAVAGPEMQVKLLQSLGLKSTLITDGSSPINLFSTAFGLLG 850
Cdd:PTZ00491 790 FERIVEALGRETLIAIARAGPELQAKLLGGLGLKGYLVTDGKSPINLFNTANGLIG 845
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH