NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307568033|pdb|2XG1N| ]
View 

Chain N, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The 70s Ribosome (part 3 Of 4)

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
rpsN PRK08061
30S ribosomal protein S14; Reviewed
1-61 2.59e-32

30S ribosomal protein S14; Reviewed


:

Pssm-ID: 181216  Cd Length: 61  Bit Score: 107.27  E-value: 2.59e-32
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|.
2XG1N         1 MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 61
Cdd:PRK08061  1 MAKKSLIAKAKRKPKFKVRAYTRCERCGRPHSVYRKFGLCRICFRELAYKGQIPGVKKASW 61
 
Name Accession Description Interval E-value
rpsN PRK08061
30S ribosomal protein S14; Reviewed
1-61 2.59e-32

30S ribosomal protein S14; Reviewed


Pssm-ID: 181216  Cd Length: 61  Bit Score: 107.27  E-value: 2.59e-32
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|.
2XG1N         1 MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 61
Cdd:PRK08061  1 MAKKSLIAKAKRKPKFKVRAYTRCERCGRPHSVYRKFGLCRICFRELAYKGQIPGVKKASW 61
RpsN COG0199
Ribosomal protein S14 [Translation, ribosomal structure and biogenesis]
1-61 7.88e-23

Ribosomal protein S14 [Translation, ribosomal structure and biogenesis]


Pssm-ID: 223277  Cd Length: 61  Bit Score: 83.06  E-value: 7.88e-23
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|.
2XG1N        1 MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 61
Cdd:COG0199  1 RAMAKLKLKALPRPKSPGRGRNRCRRCGRPRGVIRKFGLCRICFRELAHKGEIPGVKKASW 61
Ribosomal_S14 pfam00253
Ribosomal protein S14p/S29e; This family includes both ribosomal S14 from prokaryotes and S29 ...
9-58 5.19e-17

Ribosomal protein S14p/S29e; This family includes both ribosomal S14 from prokaryotes and S29 from eukaryotes.


Pssm-ID: 249718  Cd Length: 53  Bit Score: 67.94  E-value: 5.19e-17
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
2XG1N          9 KAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRK 58
Cdd:pfam00253  4 SKLPRNSSPTRGRNRCVLTGRPRGVIRKFGLSRICFRELAHDGLIPGVKK 53
rps14 CHL00074
ribosomal protein S14
17-61 1.86e-13

ribosomal protein S14


Pssm-ID: 214354  Cd Length: 100  Bit Score: 59.43  E-value: 1.86e-13
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*
2XG1N         17 KVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 61
Cdd:CHL00074  56 PTRLHNRCFLTGRPRGNYRDFGLSRHVLREMAHACLLPGVTKSSW 100
 
Name Accession Description Interval E-value
rpsN PRK08061
30S ribosomal protein S14; Reviewed
1-61 2.59e-32

30S ribosomal protein S14; Reviewed


Pssm-ID: 181216  Cd Length: 61  Bit Score: 107.27  E-value: 2.59e-32
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|.
2XG1N         1 MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 61
Cdd:PRK08061  1 MAKKSLIAKAKRKPKFKVRAYTRCERCGRPHSVYRKFGLCRICFRELAYKGQIPGVKKASW 61
RpsN COG0199
Ribosomal protein S14 [Translation, ribosomal structure and biogenesis]
1-61 7.88e-23

Ribosomal protein S14 [Translation, ribosomal structure and biogenesis]


Pssm-ID: 223277  Cd Length: 61  Bit Score: 83.06  E-value: 7.88e-23
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|.
2XG1N        1 MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 61
Cdd:COG0199  1 RAMAKLKLKALPRPKSPGRGRNRCRRCGRPRGVIRKFGLCRICFRELAHKGEIPGVKKASW 61
Ribosomal_S14 pfam00253
Ribosomal protein S14p/S29e; This family includes both ribosomal S14 from prokaryotes and S29 ...
9-58 5.19e-17

Ribosomal protein S14p/S29e; This family includes both ribosomal S14 from prokaryotes and S29 from eukaryotes.


Pssm-ID: 249718  Cd Length: 53  Bit Score: 67.94  E-value: 5.19e-17
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
2XG1N          9 KAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRK 58
Cdd:pfam00253  4 SKLPRNSSPTRGRNRCVLTGRPRGVIRKFGLSRICFRELAHDGLIPGVKK 53
rpsN PRK08881
30S ribosomal protein S14; Reviewed
17-61 3.69e-16

30S ribosomal protein S14; Reviewed


Pssm-ID: 181574  Cd Length: 101  Bit Score: 66.71  E-value: 3.69e-16
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*
2XG1N         17 KVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 61
Cdd:PRK08881  57 PTRLRNRCELTGRPRGYYRKFGLSRIKLRELAHRGEIPGVVKASW 101
rps14 CHL00074
ribosomal protein S14
17-61 1.86e-13

ribosomal protein S14


Pssm-ID: 214354  Cd Length: 100  Bit Score: 59.43  E-value: 1.86e-13
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*
2XG1N         17 KVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 61
Cdd:CHL00074  56 PTRLHNRCFLTGRPRGNYRDFGLSRHVLREMAHACLLPGVTKSSW 100
rpsN PRK06911
30S ribosomal protein S14; Reviewed
18-61 8.12e-10

30S ribosomal protein S14; Reviewed


Pssm-ID: 180742  Cd Length: 100  Bit Score: 49.68  E-value: 8.12e-10
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....
2XG1N         18 VRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 61
Cdd:PRK06911  57 VRYVTRCKQCGRPHAVYRKFNLCRICLRQQLMVGNIPGGRKSSW 100
rps14P PRK05766
30S ribosomal protein S14P; Reviewed
19-50 3.04e-03

30S ribosomal protein S14P; Reviewed


Pssm-ID: 235598  Cd Length: 52  Bit Score: 30.63  E-value: 3.04e-03
                        10        20        30
                ....*....|....*....|....*....|....
2XG1N        19 RAYTRCVRCGRARSVYRFFG--LCRICLRELAHK 50
Cdd:PRK05766 12 KGARECQRCGRKQGLIRKYGlyLCRQCFREVAPK 45
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH