NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307568002|pdb|2XG0|F]
View 

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
rplD PRK05319
50S ribosomal protein L4; Provisional
16-207 5.72e-89

50S ribosomal protein L4; Provisional


:

Pssm-ID: 235404  Cd Length: 205  Bit Score: 263.10  E-value: 5.72e-89
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        16 GRRELAADLPA-EINPHLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKP 94
Cdd:PRK05319  14 GEVELSDAVFGvEPNEALLHQVVVAQLANARQGTHATKTRSEVSGGGKKPWRQKGTGRARQGSIRSPQWRGGGVVFGPKP 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        95 RDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLdgsESVLLVTG--NELVRRAARNLPW 172
Cdd:PRK05319  94 RDYSQKLNKKVRRLALRSALSEKAREGRLVVVDDLSLEAPKTKELAAKLKNLGL---KKVLIVTDevDENLYLSARNLPN 170
                        170       180       190
                 ....*....|....*....|....*....|....*
2XG0_F       173 VVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRIG 207
Cdd:PRK05319 171 VDVLPAQGLNVYDLLRADKVVLTKAAVKKLEERLA 205
 
Name Accession Description Interval E-value
rplD PRK05319
50S ribosomal protein L4; Provisional
16-207 5.72e-89

50S ribosomal protein L4; Provisional


Pssm-ID: 235404  Cd Length: 205  Bit Score: 263.10  E-value: 5.72e-89
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        16 GRRELAADLPA-EINPHLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKP 94
Cdd:PRK05319  14 GEVELSDAVFGvEPNEALLHQVVVAQLANARQGTHATKTRSEVSGGGKKPWRQKGTGRARQGSIRSPQWRGGGVVFGPKP 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        95 RDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLdgsESVLLVTG--NELVRRAARNLPW 172
Cdd:PRK05319  94 RDYSQKLNKKVRRLALRSALSEKAREGRLVVVDDLSLEAPKTKELAAKLKNLGL---KKVLIVTDevDENLYLSARNLPN 170
                        170       180       190
                 ....*....|....*....|....*....|....*
2XG0_F       173 VVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRIG 207
Cdd:PRK05319 171 VDVLPAQGLNVYDLLRADKVVLTKAAVKKLEERLA 205
rplD_bact TIGR03953
50S ribosomal protein L4, bacterial/organelle; Members of this protein family are ribosomal ...
26-204 3.37e-86

50S ribosomal protein L4, bacterial/organelle; Members of this protein family are ribosomal protein L4. This model recognizes bacterial and most organellar forms, but excludes homologs from the eukaryotic cytoplasm and from archaea. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 274877  Cd Length: 188  Bit Score: 255.50  E-value: 3.37e-86
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F         26 AEINPHLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKV 105
Cdd:TIGR03953  10 VEPNEHLLHQVVKAQLANRRQGTHKTKTRSEVSGGGKKPWRQKGTGRARQGSIRSPLWRGGGVAFGPKPRDYSYKLNKKV 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        106 RKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGseSVLLVTG--NELVRRAARNLPWVVTLAPEGLNV 183
Cdd:TIGR03953  90 RRLALRSALSEKAREGKLVVVDDFDLEEPKTKDLAKILKNLGLGK--KVLIVTDevDENLYLSARNLPNVKVLPANGLNV 167
                         170       180
                  ....*....|....*....|.
2XG0_F        184 YDIVRTERLVMDLDAWEVFQN 204
Cdd:TIGR03953 168 YDLLRADKVVITEAAVKKLEE 188
Ribosomal_L4 pfam00573
Ribosomal protein L4/L1 family; This family includes Ribosomal L4/L1 from eukaryotes and ...
26-205 1.55e-76

Ribosomal protein L4/L1 family; This family includes Ribosomal L4/L1 from eukaryotes and archaebacteria and L4 from eubacteria. L4 from yeast has been shown to bind rRNA.


Pssm-ID: 249969  Cd Length: 190  Bit Score: 230.83  E-value: 1.55e-76
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F         26 AEINPHLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKV 105
Cdd:pfam00573  10 AEIRPDLLHRVVVAQLANRRQGTASTKTRSEVSGGGKKPWRQKGTGRARAGSIRSPLWRGGGVAFGPKPRDYSYKLNKKV 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        106 RKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGsESVLLVTG--NELVRRAARNLPWVVTLAPEGLNV 183
Cdd:pfam00573  90 RRLALRSALSAKAAEGKLVVVDDFELEIPKTKEAVKLLKKLGLKG-KKVLIVVDekDENLYLSARNLPGVDVVTVNGLNV 168
                         170       180
                  ....*....|....*....|..
2XG0_F        184 YDIVRTERLVMDLDAWEVFQNR 205
Cdd:pfam00573 169 YDLLPADKVVITKSALEKLEER 190
RplD COG0088
Ribosomal protein L4 [Translation, ribosomal structure and biogenesis]; linked to 3D-structure
8-210 5.79e-61

Ribosomal protein L4 [Translation, ribosomal structure and biogenesis]; linked to 3D-structure


Pssm-ID: 223166  Cd Length: 214  Bit Score: 191.66  E-value: 5.79e-61
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        8 QIPVLSPSGRRELAADLPAEI-----NPHLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPI 82
Cdd:COG0088   3 KLKVYDLDGEEVGEVELLPEVfgperNEDLIHRAVLAQLANRRQGTHSTKTRGEVSGGGKKPWGQKGTGRARQGSIRSPQ 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F       83 FVGGGVVFGPKP-RDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFA-GVNGKTKEFLAWAKEAGLDgSESVLLVTGN 160
Cdd:COG0088  83 WRGGGVAHGPKPeRDYSQKLNKKERRLALRSALSAKARAGKLVVVRGHVfEDAPKTKELVEFLKKLGLD-VKRLLIVKGE 161
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|...
2XG0_F      161 --ELVRRAARNLPWV-VTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRIGGEA 210
Cdd:COG0088 162 rdGNGKLSARNLKNVkVVLVVGGLPVVDVLRADKLVITKLAPGKIEERLTVWE 214
rpl4 CHL00147
ribosomal protein L4; Validated
31-204 4.38e-35

ribosomal protein L4; Validated


Pssm-ID: 214375  Cd Length: 215  Bit Score: 124.74  E-value: 4.38e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        31 HLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKVRKkgL 110
Cdd:CHL00147  36 YLLHRALVRQNNNQRQGTASTKTRSEVRGGGRKPWKQKGTGRARAGSNRSPLWKGGGVIFGPKPKTYSNKLNKKERR--L 113
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F       111 AMAVADRAREGKLLLVEAFAGV--NGKTKEFLAWAKEAGLDGSESVLLVTG--NELVRRAARNLPWVVTLAPEGLNVYDI 186
Cdd:CHL00147 114 ALRTLLYNKSNNITVVENFESSitNPKTKAFINLLKKLNINLDQKILIIVPekTENLYLSTRNLKNVELISADTLNIKSL 193
                        170
                 ....*....|....*...
2XG0_F       187 VRTERLVMDLDAWEVFQN 204
Cdd:CHL00147 194 LKAKQIIITKEALKIIEE 211
rplD PRK14907
50S ribosomal protein L4; Provisional
42-206 8.28e-35

50S ribosomal protein L4; Provisional


Pssm-ID: 184900 [Multi-domain]  Cd Length: 295  Bit Score: 126.22  E-value: 8.28e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        42 AKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKP-RDYSYTLPKKVRKKGLAMAVADRARE 120
Cdd:PRK14907 130 ASRRQGTHKVKTRAEVSGTGKKPWRQKGTGRARAGSTRSPIFVGGGRAFGPTPeRNYKLKVNKKVRFNAFVSALTLLANS 209
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F       121 gKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWE 200
Cdd:PRK14907 210 -KAVLVDDFKLEKISTKDLIKKLTKLKINNLKHILIVSNDENIFKSARNLQNVIVVKPTSLSVELLIAADVLVLSKESIE 288

                 ....*.
2XG0_F       201 VFQNRI 206
Cdd:PRK14907 289 NLEGRI 294
 
Name Accession Description Interval E-value
rplD PRK05319
50S ribosomal protein L4; Provisional
16-207 5.72e-89

50S ribosomal protein L4; Provisional


Pssm-ID: 235404  Cd Length: 205  Bit Score: 263.10  E-value: 5.72e-89
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        16 GRRELAADLPA-EINPHLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKP 94
Cdd:PRK05319  14 GEVELSDAVFGvEPNEALLHQVVVAQLANARQGTHATKTRSEVSGGGKKPWRQKGTGRARQGSIRSPQWRGGGVVFGPKP 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        95 RDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLdgsESVLLVTG--NELVRRAARNLPW 172
Cdd:PRK05319  94 RDYSQKLNKKVRRLALRSALSEKAREGRLVVVDDLSLEAPKTKELAAKLKNLGL---KKVLIVTDevDENLYLSARNLPN 170
                        170       180       190
                 ....*....|....*....|....*....|....*
2XG0_F       173 VVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRIG 207
Cdd:PRK05319 171 VDVLPAQGLNVYDLLRADKVVLTKAAVKKLEERLA 205
rplD_bact TIGR03953
50S ribosomal protein L4, bacterial/organelle; Members of this protein family are ribosomal ...
26-204 3.37e-86

50S ribosomal protein L4, bacterial/organelle; Members of this protein family are ribosomal protein L4. This model recognizes bacterial and most organellar forms, but excludes homologs from the eukaryotic cytoplasm and from archaea. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 274877  Cd Length: 188  Bit Score: 255.50  E-value: 3.37e-86
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F         26 AEINPHLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKV 105
Cdd:TIGR03953  10 VEPNEHLLHQVVKAQLANRRQGTHKTKTRSEVSGGGKKPWRQKGTGRARQGSIRSPLWRGGGVAFGPKPRDYSYKLNKKV 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        106 RKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGseSVLLVTG--NELVRRAARNLPWVVTLAPEGLNV 183
Cdd:TIGR03953  90 RRLALRSALSEKAREGKLVVVDDFDLEEPKTKDLAKILKNLGLGK--KVLIVTDevDENLYLSARNLPNVKVLPANGLNV 167
                         170       180
                  ....*....|....*....|.
2XG0_F        184 YDIVRTERLVMDLDAWEVFQN 204
Cdd:TIGR03953 168 YDLLRADKVVITEAAVKKLEE 188
Ribosomal_L4 pfam00573
Ribosomal protein L4/L1 family; This family includes Ribosomal L4/L1 from eukaryotes and ...
26-205 1.55e-76

Ribosomal protein L4/L1 family; This family includes Ribosomal L4/L1 from eukaryotes and archaebacteria and L4 from eubacteria. L4 from yeast has been shown to bind rRNA.


Pssm-ID: 249969  Cd Length: 190  Bit Score: 230.83  E-value: 1.55e-76
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F         26 AEINPHLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKV 105
Cdd:pfam00573  10 AEIRPDLLHRVVVAQLANRRQGTASTKTRSEVSGGGKKPWRQKGTGRARAGSIRSPLWRGGGVAFGPKPRDYSYKLNKKV 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        106 RKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGsESVLLVTG--NELVRRAARNLPWVVTLAPEGLNV 183
Cdd:pfam00573  90 RRLALRSALSAKAAEGKLVVVDDFELEIPKTKEAVKLLKKLGLKG-KKVLIVVDekDENLYLSARNLPGVDVVTVNGLNV 168
                         170       180
                  ....*....|....*....|..
2XG0_F        184 YDIVRTERLVMDLDAWEVFQNR 205
Cdd:pfam00573 169 YDLLPADKVVITKSALEKLEER 190
RplD COG0088
Ribosomal protein L4 [Translation, ribosomal structure and biogenesis]; linked to 3D-structure
8-210 5.79e-61

Ribosomal protein L4 [Translation, ribosomal structure and biogenesis]; linked to 3D-structure


Pssm-ID: 223166  Cd Length: 214  Bit Score: 191.66  E-value: 5.79e-61
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        8 QIPVLSPSGRRELAADLPAEI-----NPHLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPI 82
Cdd:COG0088   3 KLKVYDLDGEEVGEVELLPEVfgperNEDLIHRAVLAQLANRRQGTHSTKTRGEVSGGGKKPWGQKGTGRARQGSIRSPQ 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F       83 FVGGGVVFGPKP-RDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFA-GVNGKTKEFLAWAKEAGLDgSESVLLVTGN 160
Cdd:COG0088  83 WRGGGVAHGPKPeRDYSQKLNKKERRLALRSALSAKARAGKLVVVRGHVfEDAPKTKELVEFLKKLGLD-VKRLLIVKGE 161
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|...
2XG0_F      161 --ELVRRAARNLPWV-VTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRIGGEA 210
Cdd:COG0088 162 rdGNGKLSARNLKNVkVVLVVGGLPVVDVLRADKLVITKLAPGKIEERLTVWE 214
rplD PRK14547
50S ribosomal protein L4; Provisional
9-202 6.85e-43

50S ribosomal protein L4; Provisional


Pssm-ID: 184735  Cd Length: 298  Bit Score: 147.42  E-value: 6.85e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F         9 IPVLSPSGRRELAADLPAEI-----NPHLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIF 83
Cdd:PRK14547   4 CDVLDWQGKKVGSAELPLKVfdvetNIPLIHQVVVAQMAAARQGTHHTKTRAEVRGGGKKPWRQKGTGRARQGSIRAPQW 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        84 VGGGVVFGPKPRDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVN-GKTKeflAWAKEAGLDGSESVLLVT---G 159
Cdd:PRK14547  84 RGGGTVHGPRPREYNQRTPKKMRQAALRGALSDRARDNRLIVVESLQDGDpPSTK---AVAQALSVMEDQRALLVVaerS 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
2XG0_F       160 NELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVF 202
Cdd:PRK14547 161 DAVERLSVRNLARVHVLGADQLNTYDVLNVDWVVFTQSALEAF 203
rpl4 CHL00147
ribosomal protein L4; Validated
31-204 4.38e-35

ribosomal protein L4; Validated


Pssm-ID: 214375  Cd Length: 215  Bit Score: 124.74  E-value: 4.38e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        31 HLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKVRKkgL 110
Cdd:CHL00147  36 YLLHRALVRQNNNQRQGTASTKTRSEVRGGGRKPWKQKGTGRARAGSNRSPLWKGGGVIFGPKPKTYSNKLNKKERR--L 113
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F       111 AMAVADRAREGKLLLVEAFAGV--NGKTKEFLAWAKEAGLDGSESVLLVTG--NELVRRAARNLPWVVTLAPEGLNVYDI 186
Cdd:CHL00147 114 ALRTLLYNKSNNITVVENFESSitNPKTKAFINLLKKLNINLDQKILIIVPekTENLYLSTRNLKNVELISADTLNIKSL 193
                        170
                 ....*....|....*...
2XG0_F       187 VRTERLVMDLDAWEVFQN 204
Cdd:CHL00147 194 LKAKQIIITKEALKIIEE 211
rplD PRK14907
50S ribosomal protein L4; Provisional
42-206 8.28e-35

50S ribosomal protein L4; Provisional


Pssm-ID: 184900 [Multi-domain]  Cd Length: 295  Bit Score: 126.22  E-value: 8.28e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F        42 AKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKP-RDYSYTLPKKVRKKGLAMAVADRARE 120
Cdd:PRK14907 130 ASRRQGTHKVKTRAEVSGTGKKPWRQKGTGRARAGSTRSPIFVGGGRAFGPTPeRNYKLKVNKKVRFNAFVSALTLLANS 209
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_F       121 gKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWE 200
Cdd:PRK14907 210 -KAVLVDDFKLEKISTKDLIKKLTKLKINNLKHILIVSNDENIFKSARNLQNVIVVKPTSLSVELLIAADVLVLSKESIE 288

                 ....*.
2XG0_F       201 VFQNRI 206
Cdd:PRK14907 289 NLEGRI 294
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH