Conserved Protein Domain Family
LNS2

?
smart00775: LNS2 
This domain is found in Saccharomyces cerevisiae protein SMP2, proteins with an N-terminal lipin domain and phosphatidylinositol transfer proteins.
SMP2 is involved in plasmid maintenance and respiration. Lipin proteins are involved in adipose tissue development and insulin resistance.
Statistics
?
PSSM-Id: 197870
View PSSM: smart00775
Aligned: 29 rows
Threshold Bit Score: 151.656
Threshold Setting Gi: 268572979
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

smart00775 is a member of the superfamily cl21460.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71018759  1096 IVVSDIDGTITKSDALGHVFTMIGR--D-WTHIGVAKLYTDIAR-------NGYRIMYLTSRAIGQADSTRDYLKGIRQN 1165
gi 71653372   454 LVVSDVDGTITKSDLWGHLMPLIGR--D-WTHPGICSLYSKIDR-------NGYKFVYLTARSVSQVSMTRNFLWKIEQD 523
gi 157864288  681 LVVSDVDGTITKSDLLGHFYAMLGKgaD-WTHPGICNLYSKIER-------NGYRMVYLTARSVSQINQTKSYLFTLQQD 752
gi 66824329  1088 IVISDIDGTITKSDVFGQVLPLIGK--D-WSHIGVAELYSNIKE-------NGYQIIYLTSRAIGQANLTRTYISSVKQT 1157
gi 72391748   441 LVISDVDGTITKSDVLGHIMPLIGR--D-WTHPGICSLYSQIQK-------NGYRLVYLTARSVSQISMTRKFLWNIQQN 510
gi 18859245   692 VVFS-IDGSFAAS------VSLMGS--DpKVRPGAVDVVRHWQD-------LGYLIIYITGRPDMQKQRVVSWLSQ---- 751
gi 37993630  1022 VVFS-IDGSFTAG------VSIMGS--DpKVRAGAVDVVRHWQD-------SGYLIVYVTGRPDMQKHRVVAWLSQ---- 1081
gi 27529911  1118 VVFS-IDGSFAAS------VSIMGS--DpKVRAGAVDVVRHWQD-------LGYLIIYVTGRPDMQKQRVVAWLAQ---- 1177
gi 198421886  227 VIFS-IDGSFTAS------VSIMGS--DpKVRPGAVDVVRLWQD-------LGYLIIYVTGRPDMQKHRVVTWLSQ---- 286
gi 15896191   176 yVVFDMDGTLTTTD-FEDVKQYAGE--F-FNSNYVAKMYPDVDNvvkyyasKGYGILYLTARPYWLSEESQTWLWK---N 248
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71018759  1166 G-----------------------------YQLPDGPVIMSPDRLIASLHREVILRKPEVFKMACLRDIARLFGadprta 1216
gi 71653372   524 G-----------------------------FRLPKGPVLTAPQRFFTALTQEV-SKKSHVFKIACLKSVLDTFP------ 567
gi 157864288  753 G-----------------------------VRLPMGPVLTAPQRFFTALTQEV-SKQSHVFKIACLASVRATFP------ 796
gi 66824329  1158 GsnqntlggsgttggansgvnglnqqqsipFTLPEGPVFMSPNRLLTSFNREVIKRNPEEFKIACLQDIQNIFP------ 1231
gi 72391748   511 G-----------------------------VSLPKGPVLTAPKRLFSALAQEV-AMKSHFFKIACLQKVVNAFP------ 554
gi 18859245   752 ------------------------------HNFPQGMVFFS----------EGLVHDPLRQKTIFLKSLVKEC------- 784
gi 37993630  1082 ------------------------------HNFPHGVVSFCDG----------LTHDPLRQKAMFLQSLVQEVE------ 1115
gi 27529911  1178 ------------------------------HNFPHGVVSFCDG----------LVHDPLRHKANFLKLLISEL------- 1210
gi 198421886  287 ------------------------------HNFPHGMVWFGDG----------ISKDPLKQKTILLKNLK---A------ 317
gi 15896191   249 G-------------------------------FPMGLLHTYTGGDV------LLGEEAESFKAGYLNQLKS--------- 282
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71018759  1217 hsqsegdhkrldtevlekaqkgagvderpdagtastsstdtasadplqdaaaasdassirsgnklspssssmslptlasv 1296
gi 71653372       --------------------------------------------------------------------------------
gi 157864288      --------------------------------------------------------------------------------
gi 66824329       --------------------------------------------------------------------------------
gi 72391748       --------------------------------------------------------------------------------
gi 18859245       --------------------------------------------------------------------------------
gi 37993630       --------------------------------------------------------------------------------
gi 27529911       --------------------------------------------------------------------------------
gi 198421886      --------------------------------------------------------------------------------
gi 15896191       --------------------------------------------------------------------------------
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|..
gi 71018759  1297 dplsaprkkeEHPTPFYAGFGNRITDALSYRSVNIPSSRIFTIDTNGEVKME 1348
gi 71653372   568 ----------AQSKPFYAGFGNRFNDVVSYTATQIPQHKIFIIDPNSVLHVy 609
gi 157864288  797 ----------PSTKPFFAGFGNRYNDVISYDAAGIPTHKIFIIDPSSVLHVC 838
gi 66824329  1232 ----------PTMSPFYAGFGNRNTDAISYNAVGVPKGKTFTINPLGVIntt 1273
gi 72391748   555 ----------QKTKPFYAGFGNRLSDMLSYLAVMVPEHKIYVVDSKSLVRVA 596
gi 18859245   785 ------------HIKISAAYGS-MKDMSVYSTLGLAPNQIYIVGRPSKKHQH 823
gi 37993630  1116 -------------LNIVAGYGS-PKDVAVYAALGLSPSQTYIVGRAVRKLQA 1153
gi 27529911  1211 ------------HLRVHAAYGS-TKDVAVYSAISLSPMQIYIVGRPTKKLQQ 1249
gi 198421886  318 ----------DNKLIYAAGYGS-SKDIAVYSQLGIEPDRIFIVGKVSKKQan 358
gi 15896191   283 -----------QGIEFDYGFGNEKTDVEAYSNIGIAKSNIFTIGKNRGIDGS 323
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap