Conserved Protein Domain Family
BDHCT

?
pfam08072: BDHCT 
BDHCT (NUC031) domain
This is a C-terminal domain in Bloom's syndrome DEAD helicase subfamily.
Links
?
Statistics
?
PSSM-Id: 116679
View PSSM: pfam08072
Aligned: 3 rows
Threshold Bit Score: 56.5458
Threshold Setting Gi: 123893074
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam08072 is a member of the superfamily cl06901.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 1705486    371 QLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLL 411
gi 17366086    78 QLYSVMEDICKLVDAIPLHELTSISCAKELLQQRELRRKLL 118
gi 123893074  340 HLLSVMLEICDLVDKIPISELHVLSCGMD-----------L 369
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap