NCBI CDD Logo
?
pfam07810: TMC 
TMC domain
These sequences are similar to a region conserved amongst various protein products of the transmembrane channel-like (TMC) gene family, such as Transmembrane channel-like protein 3 and EVIN2 - this region is termed the TMC domain. Mutations in these genes are implicated in a number of human conditions, such as deafness and epidermodysplasia verruciformis. TMC proteins are thought to have important cellular roles, and may be modifiers of ion channels or transporters.
Statistics
?
PSSM-Id: 254445
View PSSM: pfam07810
Aligned: 26 rows
Threshold Bit Score: 114.644
Threshold Setting Gi: 296452937
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:

pfam07810 is a member of the superfamily cl06719.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74811654   399 CWETAIGQELYRLLVVDFFISTVLLSAVRGVRYLLHAR-----YgpargrAGPLAPYLTPPPFCIETHSLGLVYNQTLLW 473
gi 82271248   432 CWETAVGIEFVKLTVSDIQVSYLTILIGDFARAVIVRF-----Lnyc-wcWDLEAGFPSYGEFDISGNVLGLVFNQGMIW 505
gi 121942798  482 CWETMVGQEFVRLTVSDVLTTYVTILIGDFLRACFVRF-----Cnyc-wcWDLEYGYPSYTEFDISGNVLALIFNQGMIW 555
gi 325511376  499 CWETYVGQEMLKLSIIDMLFTVASILLIDFFRGLFVRY-----Lsdy-wcWDLESKFPEYGEFKIAENVLHLVYNQGMIW 572
gi 121992391 1129 CWETSLGQELSKVIVFDGLMSIVAPLCIDFLRALFVRY-----Vnqn-wcWDMEKTFPQYGDFKIAENILTLINNQGQVW 1202
gi 74713450   486 CWETQVGQEMYKLMIFDFIIILAVTLFVDFPRKLLVTY-----Cs-----SCKLIQCWGQQEFAIPDNVLGIVYGQTICW 555
gi 82197654   480 CWESAVGQEMYKLLIFDFMIIIAMTLFVDFPRKLLVTY-----C------SWKLVQWWGLQEFGISDNVLEIIYGQTICW 548
gi 82261567   466 CWETRVGQEMYKLTIFDFIIIAANTIFVEFPRKLIVRH-----C------DWGLAKLWGQQEFAIPQNVLEIVYGQTICW 534
gi 122094052  432 CWETSVGQEIYRLIVIDFVVSVIFLACLQASRYAMNRY-----Y----------NRSISLPEFCITNNSLGLVYNQTLLW 496
gi 189519052  517 CWETMVGQEFVRLIISDTMTTYITLLIGDFMRAVLVRFlnncwC------WDLEYGFPSYSEFDVSGNVLGLIFNQGMIW 590
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 74811654   474 FGVLFAPPLLLLVALKLLLVFYVNKCELMYLCQPPARLWRSS 515
gi 82271248   506 MGAFYAPGLIGINVLRLLSSMYYQCWAVMATNVPHERVFKAS 547
gi 121942798  556 MGSFFAPSLPGINILRLHTSMYFQCWAVMCCNVPEARVFKAS 597
gi 325511376  573 MGAFFSPCLPAFNVLKLIGLMYLRSWAVLTCNVPHQQVFRAS 614
gi 121992391 1203 MGIFFSPGLVLINLVKLMIMMYFRSWIVLTCNVPHEVVFKAS 1244
gi 74713450   556 IGAFFSPLLPAIATLKFIIIFYVKEWSLLYTCRPSPRPFRAS 597
gi 82197654   549 IGTFFSPLLPAIATIKYFIIFYIKKISLIHTRKPASRPIRAS 590
gi 82261567   535 IGTFYSPILPAICTIKYFFIFYIKKVSLINNCRPATRPFRAS 576
gi 122094052  497 FGLLFSPMLCVVVAAKLFLTFYIKKLSLIYFCKPQSKLWRSS 538
gi 189519052  591 MGAFYAPCLPALNLLRLHVSMYLQCWAVMCCNVPQERVFKAS 632
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap