NCBI CDD Logo
?
pfam07714: Pkinase_Tyr 
Click on image for an interactive view with Cn3D
Protein tyrosine kinase
Statistics
?
PSSM-Id: 254379
View PSSM: pfam07714
Aligned: 145 rows
Threshold Bit Score: 205.038
Threshold Setting Gi: 73920239
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:

pfam07714 is classified as a model that may span more than one domain.
pfam07714 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1U59_A         12 LIADIELGCGNFGSVRQGVYR-----------MRKKQIDVAIKVLkqGTEKAd-TEEMMREAQIMHQLDNPYIVRLIGVC 79
gi 215274013  583 LVQGEHLGRGTRTHIYSGTLMdykd---degtSEEKKIKVILKVLdpSHRDI--SLAFFEAASMMRQVSHKHIVYLYGVC 657
gi 21263757   580 IVQGEHLGRGTRTNIYAGILKpksdd-eddlgGYSQEVKVVLKVL--GSGHRdiSLAFFETASMMRQISHKHTALLYGVC 656
gi 82070078   592 IEQEEHLGRGTRTNIYSGTLRvkseededagySSFQEVKVVLKLL--SYGHRdiSLAFFETASMMRQVSHKHIVLLYGVC 669
gi 12643404   545 LIFNESLGQGTFTKIFKGVRRevg------dyGQLHETEVLLKVL--DKAHRnySESFFEAASMMSKLSHKHLVLNYGVC 616
gi 82071165   509 LQTTEGLGQGTFTQVFRGIRRevg------dyGEVHKMEVVMKIL--DKSHRnyTESFFESASMMSQLSHKHLLLNYGIC 580
gi 82069421   517 LIRGESLGQGSFTHIYKGIKRdq-------kdDEFYQTPVVLKVM--DSSHRncSESFLEAASIMSQLSHKHLVLLHGVS 587
gi 2499671    517 LEWHENLGHGSFTKIFHGHRRev-------vdGETHDTEVLLKVM--DSRHQncMESFLEAASLMSQVSYPHLVLLHGVC 587
gi 161789020  853 IQFIQKVGEGAFSEVWEGWWK---------------GIHVAIKKLkiIGDEEqfKERFIREVQNLKKGNHQNIVMFIGAC 917
gi 74996665  1057 VAIVEKVGAGSFANVFLGIWN---------------GYKVAIKILknESISN--DEKFIKEVSSLIKSHHPNVVTFMGAC 1119
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1U59_A         80 Q-Ae-aLMLVMEMAGGGPLHKFLVGK-----REEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVN------- 145
gi 215274013  658 V-RdveNIMVEEFVEGGPLDLFMHRK-----SDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLARegidsec 731
gi 21263757   657 VrHqe-nIMVEEFVQYGPLDLFMRRQ-----TTPLSTAWKFQVAKQLASALSYLEDKKMVHGYVCSKNILVARdgl-dge 729
gi 82070078   670 VhHqe-nIMVEEFVQLGPLDVFMRRQ-----QSPLSIPWKFQVAKQLASALSYLEDKKLVHGFVCAKNILLARdgmgtde 743
gi 12643404   617 VcGde-nILVQEFVKFGSLDTYLKKN-----KNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIReedrktg 690
gi 82071165   581 VcAde-hIMVQEYVRFGSLDTYLKRN-----RNTINITWKLEVAKQLAWALHHLEEKSLTHGNVCARNVLVTReedrktg 654
gi 82069421   588 L-Gkd-sIMVQEYIRHGPLDLYLKKNh---sEGKVTTSWKLQVAKQLAYALNYLEDKKITHGNVSAKKVLLTRegdaass 662
gi 2499671    588 M-Agd-sIMVQEFVYLGAIDTYLRKR-----GHLVPASWKLQVTKQLAYALNYLEDKGLPHGNVSARKVLLARegv--dg 658
gi 161789020  918 Yk---pACIITEYMAGGSLYNILHNPnsstpKVKYSFPLVLKMATDMALGLLHLHSITIVHRDLTSQNILLDE------- 987
gi 74996665  1120 Id---pPCIFTEYLQGGSLYDVLHIQ-----KIKLNPLMMYKMIHDLSLGMEHLHSIQMLHRDLTSKNILLDE------- 1184
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1U59_A        146 RH-YAKISDFGLSKALgADDSYYTARSAGKWPLKWYAPECINFRK-FSSRSDVWSYGVTMWEALSYGQKPyk-kmKGPEV 222
gi 215274013  732 GP-FIKLSDPGIPITV-------LSRQECIERIPWIAPECVEDSKnLSVAADKWSFGTTLWEICYNGEIPlk-dkTLIEK 802
gi 21263757   730 GGpFIKLSDPGIPITV-------LSREECVDRIPWIAPECVKDTAnLTIAADKWSFGTTLWEICYNGEIPlk-dkKLSE- 800
gi 82070078   744 GGpFIKLSDPGIPITV-------LTREECVHRIPWIAPECVKNVSaLSVAADKWGFGTTLWEICYDGEVPlk-ekKLTEQ 815
gi 12643404   691 NPpFIKLSDPGISITV-------LPKDILQERIPWVPPECIENPKnLNLATDKWSFGTTLWEICSGGDKPls-alDSQR- 761
gi 82071165   655 TPpFIKLSDPGISITV-------QPREILLERIPWVPPECVKDSRnLSLAADKWSFGTTLWEIYCGGEQPla-ayDTAK- 725
gi 82069421   663 SPpFIKLNDPGVSITV-------LAKEWLVERIPWVAPECLSDPQsLALPADKWGFGATLWEIFSGGNMPvs-llEPQK- 733
gi 2499671    659 NPpFIKLSDPGVSPTV-------LSLEMLTDRIPWVAPECLQEAGtLNLEADKWGFGATTWEVFSGAPMHit-slEPAK- 729
gi 161789020  988 LG-NIKISDFGLSREK-SREGSMTMTNGGICNPRWRPPELTKNLGhYSEKVDVYCFSLVVWEILT-GEIPfs-dlDGSQA 1063
gi 74996665  1185 FK-NIKIADFGLATTL-----SDDMTLSGITNPRWRSPELTKGLV-YNEKVDVYSFGLVVYEIYT-GKIPfegldGTASA 1256
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*.
1U59_A        223 MAFI-EQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRM 267
gi 215274013  803 ERFY-ESRCRPVTPS--CKELADLMTRCMNYDPNQRPFFRAIMRDI 845
gi 21263757   801 KERFyAAQCQLATPD--CDELAKLMTHCMTYDPRQRLFFRAIVRDI 844
gi 82070078   816 KERFyETECQLATPD--CTELAELMTHCMNYDPKKRPFFRAIVRDI 859
gi 12643404   762 KLQFyEDRHQLPAPK--WAELANLINNCMDYEPDFRPSFRAIIRDL 805
gi 82071165   726 KLLFyEDKHQLPAPK--WTELASVINSCMDYEPLHRPSFRALIRDL 769
gi 82069421   734 KLQFyDSRLQLPAPR--WSELAALIAQCI-YAPSRRPCFRAIIRDI 776
gi 2499671    730 KLKFyEDRGQLPALK--WTELEGLIAQCMAYDPGRRPSFRAILRDL 773
gi 161789020 1064 SAQVaYAGLRPPIPEYCDPELKLLLTQCWEADPNDRPPFTYIVNKL 1109
gi 74996665  1257 AKAA-FENYRPAIPPDCPVSLRKLITKCWASDPSQRPSFTEILTEL 1301
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D