NCBI CDD Logo
?
pfam05038: Cytochrom_B558a 
Cytochrome Cytochrome b558 alpha-subunit
Cytochrome b-245 light chain (p22-phox) is one of the key electron transfer elements of the NADPH oxidase in phagocytes.
Statistics
?
PSSM-Id: 252963
View PSSM: pfam05038
Aligned: 4 rows
Threshold Bit Score: 316.844
Threshold Setting Gi: 20137407
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:

pfam05038 is a member of the superfamily cl04901.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20137407    2 GQIEWAMWANEQALASGLILVAGGIVATAGRFTQWYFGTYAIAAGVLVCLLEYPRGSRAKGS-TLERCGQRYLTAVLKLL 80
gi 82083182    2 GKIEWAMWANEQALAAGLILLTGGIVGVAGQFRDWEFAAYAIAAGVFVCLLEYPRGKRNKGT-SVERTGQYCFTVCVKSF 80
gi 20137524    2 GQIEWAMWANEQALASGLILITGGIVATAGQFAQWYLGAYSIAAGVLICLLEYPRGKRSKGS-TMERCGQKYLTRAVKVF 80
gi 156371232   2 GHTEWAMWANEQGVITSFVLALGGTLGVAGMFKKYEFGAYSIALGVLVFLIEYPRGKRKQGKkTQERSYQRCLTRLVSGL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20137407   81 GPLSRNYYFRAALHLALSVPAGFLLATILGTVCLVIASIIYLLAAVRGEQWTPIEPRPKE-RPQVGGTIKQPPSNPPPRP 159
gi 82083182   81 GPLTRNYYVRAFLHAAICVPGGFILATVLGCVCLGIASLIYLAAAIRGEQWEPILPRKESaRKPVGESIKLPPQNPPPRP 160
gi 20137524   81 GPLTSNYYIRAFLHLGLSVPAGFLLATILGTACLAIASSIYLLAAIHGEHWTPIETKPKE-RPQVGGTIKQPPSNPPPRP 159
gi 156371232  82 GIVGRNYYIRFVFYLLSCIPCCFFLPTILGGFSLFFTSIIYLCAALSGEKWQPCLDSKAD-RTP-GINPSHHPTVPPPRN 159
                        170       180       190
                 ....*....|....*....|....*....|....*
gi 20137407  160 PVEARKKPGEEDATPAggppggpRVNPIPVTDEVV 194
gi 82083182  161 PAEMRRKRAEDLEAAA-------YVNPIAVTANDD 188
gi 20137524  160 PAEARKKPSEEEVAGVpgg--gpQENPMPVTDEVV 192
gi 156371232 160 P---RSQSLDNLGVSS-------------SSVNRV 178
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap