Conserved Protein Domain Family
Snf7

?
pfam03357: Snf7 
Click on image for an interactive view with Cn3D
Snf7
This family of proteins are involved in protein sorting and transport from the endosome to the vacuole/lysosome in eukaryotic cells. Vacuoles/lysosomes play an important role in the degradation of both lipids and cellular proteins. In order to perform this degradative function, vacuoles/lysosomes contain numerous hydrolases which have been transported in the form of inactive precursors via the biosynthetic pathway and are proteolytically activated upon delivery to the vacuole/lysosome. The delivery of transmembrane proteins, such as activated cell surface receptors to the lumen of the vacuole/lysosome, either for degradation/downregulation, or in the case of hydrolases, for proper localisation, requires the formation of multivesicular bodies (MVBs). These late endosomal structures are formed by invaginating and budding of the limiting membrane into the lumen of the compartment. During this process, a subset of the endosomal membrane proteins is sorted into the forming vesicles. Mature MVBs fuse with the vacuole/lysosome, thereby releasing cargo containing vesicles into its hydrolytic lumen for degradation. Endosomal proteins that are not sorted into the intralumenal MVB vesicles are either recycled back to the plasma membrane or Golgi complex, or remain in the limiting membrane of the MVB and are thereby transported to the limiting membrane of the vacuole/lysosome as a consequence of fusion. Therefore, the MVB sorting pathway plays a critical role in the decision between recycling and degradation of membrane proteins. A few archaeal sequences are also present within this family.
Statistics
?
PSSM-Id: 251895
View PSSM: pfam03357
Aligned: 34 rows
Threshold Bit Score: 109.251
Threshold Setting Gi: 115502472
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam03357 is a member of the superfamily cl21588.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2GD5_D       14 EWSLKIRKEXRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEXIRSRKAVSKLYASKAHXNSVLXGXKNQLAV 93
gi 549669    19 RIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRTVRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRM 98
gi 74948254  18 EWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEIVNARKAINRIYTSKAHLNSIQMQMKNQLST 97
gi 75206464  18 ENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAKQGQMGAVKVMAKDLIRTRHQIEKFYKLKSQLQGVSLRIQTLKST 97
gi 75025449  17 QNQRALNKAIRELDRERARMEAQEKKVIADIKNMAKKNQMDSVKVMAKDLVRTRRYIKKFIVMKANIQAVSLKVQTLKSQ 96
gi 74947681  17 KNQRALNKAMRDLDRERMKMEQQEKKIIADIKKMAKEGQMDAVKIMAKDLVRTRRYAKKFMLMKANIQAVSLKIQTLKSQ 96
gi 73917740  17 QNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSN 96
gi 75249519  16 ESKREMTQATRGIEKEIGSLQSEEKKLVLEIKRTAKSGNEGATKILARQLIRLRQQIANLQGSRAQMRGIATHTQAMHAH 95
gi 73917746  16 EQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQ 95
gi 74870586  18 ENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAKQLVEIRKQKSRTYAAAGKIQSIGYQNKNMGAN 97
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2GD5_D       94 LRVAGSLQKSTEVXKAXQSLVKIPEIQATXRELSKEXXKAGIIEEMLEDTFESMd-dQEEXEEEAEXEIDRILFEitAGA 172
gi 549669    99 NTLSNQMADSAGLMREVNSLVRLPQLRNTMIELEKELMKSGIISEMVDDTMESVgdvGEEMDEAVDEEVNKIVEQytNEK 178
gi 74948254  98 LRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSKEMMKAGIIEEMLDETMDSLe-eSEELEEEASKEVDKVLWEitDGK 176
gi 75206464  98 QAMGEAMKGVTKAMGQMNRQMNLPSLQKIMQEFERQNEKMEMVSEVMGDAIDDAl-eGDEEEEETEDLVSQVLDEigIDI 176
gi 75025449  97 DAMASAMKGVTKAMQSMNRQLNLPQIQKIMMEFEKQSEIMDMKEEVMGDAIDDAl-gDAGDEEETDQIVNQVLDElgIQM 175
gi 74947681  97 NTMAQAMKGVTKAMQNMNRQLNLPQIQKILQDFEKQSEMMDMKEEMINDAIDDAm-eDEGDEEETDAVVSQVLDElgLQL 175
gi 73917740  97 NSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAm-gDEEDEEESDAVVSQVLDElgLSL 175
gi 75249519  96 TSVAAGMQGATKAMAAMSKNMDPAKQAKVMREFQKQSAQMDMTTEMMSDSIDDAl-dNDEAEDETEDLTNQVLDEigIDI 174
gi 73917746  96 MKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIf-dGSDDEEESQDIVNQVLDEigIEI 174
gi 74870586  98 IALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMINDTLDDMl-nESGDEEESNAVVNKVLDEigIEI 176

                ....*..
2GD5_D      173 LGKAPSK 179
gi 549669   179 FKNVDQV 185
gi 74948254 177 LGEAPLP 183
gi 75206464 177 NQELVNA 183
gi 75025449 176 GEEMAGL 182
gi 74947681 176 GEQLGDL 182
gi 73917740 176 TDELSNL 182
gi 75249519 175 ASQLSSA 181
gi 73917746 175 SGKMAKA 181
gi 74870586 177 SGKMSSI 183
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D