Conserved Protein Domain Family
Ferric_reduct

?
pfam01794: Ferric_reduct 
Ferric reductase like transmembrane component
This family includes a common region in the transmembrane proteins mammalian cytochrome B-245 heavy chain (gp91-phox), ferric reductase transmembrane component in yeast and respiratory burst oxidase from mouse-ear cress. This may be a family of flavocytochromes capable of moving electrons across the plasma membrane. The Frp1 protein from S. pombe is a ferric reductase component and is required for cell surface ferric reductase activity, mutants in frp1 are deficient in ferric iron uptake. Cytochrome B-245 heavy chain is a FAD-dependent dehydrogenase it is also has electron transferase activity which reduces molecular oxygen to superoxide anion, a precursor in the production of microbicidal oxidants. Mutations in the sequence of cytochrome B-245 heavy chain (gp91-phox) lead to the X-linked chronic granulomatous disease. The bacteriocidal ability of phagocytic cells is reduced and is characterized by the absence of a functional plasma membrane associated NADPH oxidase. The chronic granulomatous disease gene codes for the beta chain of cytochrome B-245 and cytochrome B-245 is missing from patients with the disease.
Statistics
?
PSSM-Id: 280043
View PSSM: pfam01794
Aligned: 151 rows
Threshold Bit Score: 29.9234
Threshold Setting Gi: 81721863
Created: 21-Jun-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam01794 is a member of the superfamily cl23723.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75161398  162 LAEACLSLLLFPV---LRG---LSMF--RLLNIEFAA-SVK-YHVWFGTGLIFFSLVHGGSTLFIWTItHh--------i 223
gi 123631546  51 GAFNLLLVTLTVS---------------PIAKKFKLG-YLLqIRRLLGIYTFSYALMHLFNFLVFDLQlA---------- 104
gi 122995701  38 GGLRLLLLSLLIT---------------PLVKKFKLG-PLIkLRRPLGLWCFTWVSLHFAAWMGLDLAlM---------- 91
gi 20178152   50 MALKLLLATLLVS---------------PLARYSKQP-LLLrCRRLLGLWCFAWGTLHLLSYSILELGlSn--------- 104
gi 20178231   45 GALVLLLLTLAMT---------------PLQKLSGWP-GWIaVRRQLGLWCFTYVLLHLSAYYVFILGlD---------- 98
gi 81708864   63 LALVGLALTLTAR---------------PLNRFLP---GLLqERRYLGLLTFAFSVLHTWSQIEHVLGgSl--------- 115
gi 122498025  59 AAFFMLSATLCIG---------------PLARMDTRFlPLLyNRRHFGVLTAAVAWTHATYVYGWYFSfTpmdrmeallt 123
gi 753762917  52 TAIYFLLATLTVT---------------PLLRLTRL--NLMrFRQALGLICFAYVACHLVAWVVFDMAfL---------- 104
gi 501511175  57 WAIHFLLLTLTLS---------------PLAKWLPSP-EPIqFRRMIGVYAFVYAFAHLFTYIFFELQlD---------- 110
gi 150836284   4 YFPDPGKLLMRLSgiwASVfvvAVMSmtLVGKIKPLK-VINrYRRFIGLTAFFYGLLHFVIYLVLFAGlS---------- 72
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 75161398  224 EEEIWKWQRTGRVYVAGLISLVTGLLMWITSLPQIR-RKNFEVFYYTHHLYIVFLVAF 280
gi 123631546 105 WSLFFSEVVKRPYITIGMIAFVLLTTLAITSLNSIKrNMG-KSWQSLHNYSYFIAMLV 161
gi 122995701  92 WGLIGEELVKRTYIVVGFIAWLILLALAITSIPVLMrTMG-KRWRQLHRGVYWVAVLA 148
gi 20178152  105 IGLLGHELINRPYLTLGIISWLVLLALALTSTRWAQrKMG-ARWQKLHNWVYVVAILA 161
gi 20178231   99 WGQLGIELSKRPYIIVGMLGFVCLFLLAITSNRFAMrKLG-SRWKKLHRLVYLILGLG 155
gi 81708864  116 DGMFFLPRDMQFGVELGIFALLAMLPLALTSTDWAVrTLK-GAWKGLHQGVFFAAFLI 172
gi 122498025 124 SNTAFDQILGFPIEALGMFALFILLILAATSHDFWLsFLGAPLWKRLHLLIYLAYAII 181
gi 753762917 105 WAQMLKDVVKRPYLVFGMLAFAMLLALALTSNRFSIrRMG-AGWRKLHRLVYPAAILA 161
gi 501511175 111 MALVASEIVSRPYIIVGMIALILLVALTATSFKRLQrKMG-RKWQTLHNSIYLVLPLA 167
gi 150836284  73 WTWISSDLVEKPYIYVGVAALSIMAVLAITSTKRMMcALG-KKWKPLHRLMYLAAIGV 129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap