NCBI CDD Logo
?
pfam00664: ABC_membrane 
Click on image for an interactive view with Cn3D
ABC transporter transmembrane region
This family represents a unit of six transmembrane helices. Many members of the ABC transporter family (pfam00005) have two such regions.
Statistics
?
PSSM-Id: 250039
View PSSM: pfam00664
Aligned: 70 rows
Threshold Bit Score: 118.55
Threshold Setting Gi: 1351459
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
pfam00664 is a member of the superfamily cl18356.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3G5U_B         50 MLVGTLAAIIHGVALPLMMLIFGDMTDSfasvgnvsknstnMSEADKRamfa------------kleEEMTTYAYYYT-G 116
gi 1711613   1013 LSLLVFSQLLKHMVLVAIDYWLAKWTDSa-----------lVLSPAARncsls----------qecdLDQSVYAMVFT-L 1070
gi 1723255    918 IFLYFLFIIGGIGMNVGTNVWLKHWSE--------------VNTQLGY-------------------NPKPYFYLGIYtL 964
gi 116142      82 FLFYGILLYLGEVTKAVQPLLLGRIIAS-------------YDRDNEH-------------------ERSIAYYLAIG-L 128
gi 116141      82 FLFYGILLYFVEFTKAVQPLCLGRIIAS-------------YNAKNTY-------------------EREIAYYLALG-L 128
gi 1730876    207 YFMSIVFAILANCTSGFNPMITKRLIEF-------------VEEKAIFhs----------------mHVNKGIGYAIG-A 256
gi 1170904    231 VWAQILPKLLSDVTALMLPVLLEYFVKY-------------LNADNAT--------------------WGWGLGLALT-I 276
gi 1711613    318 LCIFGIVDHLGKENHVFQPK--TQFLGV-------------YFVSSQE-------------------FLGNAYVLAVL-L 362
gi 296439301  325 FLMSFFFKAIHDLMMFSGPQILKLLIKF-------------VNDTKAP--------------------DWQGYFYTVL-L 370
gi 6920083    287 MLLAAFFKAIHDVLAFTQPQLLRILIKF-------------VTDYNSErqddhsslqgfennhpqklPIVRGFLIAFA-M 352
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3G5U_B        117 IGAGVLIVAYIQVSFWClaAGRQIHKIRQKFFHAIMNQEIGWFDV------HDVGELNTRLTDDVSKINEGIGDKIGMFF 190
gi 1711613   1071 LCS-LGIVLCLVTSVTV---EWTGLKVAKRLHRSLLNRIILAPMRff--etTPLGSILNRFSSDCNTIDQHIPSTLECLS 1144
gi 1723255    965 FGLLSCALISLSSLTIT---VFCAIKSCRYLHDSMVKAVLRAPMSff--etTPTGRILNRFSSDVYRVDEVISRVFMFFF 1039
gi 116142     129 CLLFVVRMLLLHPAIFG--LHHIGMQMRIAMFSLIYKKTLKLSSKvl--dkISTGQLVSLLSNNLNKFDEGLALAHFVWI 204
gi 116141     129 CLLFVVRTLFLHPAVFG--LQHLGMQMRIALFSLIYKKILKMSSRvl--dkIDTGQLVSLLSNNLNKFDEGVAVAHFVWI 204
gi 1730876    257 CLMMFVNGLTFNHFFHT--SQLTGVQAKSILTKAAMKKMFNASNYar--hcFPNGKVTSFVTTDLARIEFALSFQPFLAG 332
gi 1170904    277 FLTNVIQSCSAHKYDHI--SIRTAALFETSSMALLFEKCFTVSRRslqrpdMSVGRIMNMVGNDVDNIGSLNWYVMYFWS 354
gi 1711613    363 FLALLLQRTFLQASYYV--AIETGINLRGAIQTKIYNKIMHMSTSnlsmgeMTAGQICNLVAIDTNQLMWFFFLCPNLWT 440
gi 296439301  371 FVTACLQTLVLHQYFHI--CFVSGMRIKTAVIGAVYRKALVITNSar--ksSTVGEIVNLMSVDAQRFMDLATYINMIWS 446
gi 6920083    353 FLVGFTQTSVLHQYFLN--VFNTGMYIKSALTALIYQKSLVLSNEas--glSSTGDIVNLMSVDVQKLQDLTQWLNLIWS 428
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3G5U_B        191 QAMATFFGGFIIGFTRGWKLTLVILAISPVLGLSAGIWAKILSSFTDKELHAYAKAGAVAEEVLAAIRTVIAFGGQKKEL 270
gi 1711613   1145 RSTLLCVSALTVISYVTPVFLVALLPLAVVCYFIQKYFRVASRDLQQLDDTTQLPLVSHFAETVEGLTTIRAFRYEARFQ 1224
gi 1723255   1040 RNLFQIVFVLAVICYSSPMFMILIVPLFFLYRYNQVYYTQTSRELKRLDSVTRSPLYAHFQESLGGLSTIRAYDMEDTFI 1119
gi 116142     205 APLQVLLLMGLLWDLLQASAFCGLG-FLIILSLFQARLGRMMMKYKDKRAGKINERLVITSQIIENIQSVKAYCWENAME 283
gi 116141     205 APVQVVLLMGLIWNELTEFVFCGLG-FLIMLALFQAWLGKKMMQYRDKRAGKINERLAITSEIIDNIQSVKVYCWEDAME 283
gi 1730876    333 FPAILAICIVLLIVNLGPIALVGIG-IFFGGFFISLFAFKLILGFRIAANIFTDARVTMMREVLNNIKMIKYYTWEDAYE 411
gi 1170904    355 APLQLVLCLLLLIRLVGWLRVPGMA-VLFVTLPLQAVISKHVQDVSERMASVVDLRIKRTNELLSGVRIVKFMGWEPVFL 433
gi 1711613    441 MPVQIIVGVILLYYILGVSALIGAA-VIILLAPVQYFVATKLSQAQRTTLEHSNERLKQTNEMLRGMKLLKLYAWESIFC 519
gi 296439301  447 APLQVILALYLLWLNLGPSVLAGVA-VMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFK 525
gi 6920083    429 GPFQIIICLYSLYKLLGNSMWVGVI-ILVIMMPLNSFLMRIQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYR 507
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
3G5U_B        271 ERYNNNLEEAKRLGIKKAITANISMGAAFLLIYAsYALAFWYGTSL--VISKEYSIGQVLTVFFSVLIGAFSV 341
gi 1711613   1225 QKLLEYTDSNNIASLFLTAANRWLEVCMEYIGAC-VVLIAAATSISn-SLHRELSAGLVGLGLTYALMVSNYL 1295
gi 1723255   1120 SENDIRVDTNHRIWFLYFSSNRWQAIRVEAIGAL-VVFSSAFFGVLs-AVRGNPNSGLVGLSLSYAVQITQSL 1190
gi 116142     284 KIIETIRE-TELKLTRKAAYVRYFNSSAFFFSGF-FVVFLSIVPHL---LLDGISLRKIFTTISFSIVLRMAV 351
gi 116141     284 KIIDDIRQ-VELKLTRKVAYCRYFSSSAFFFSGF-FVVFLSVVPYA---FIHTIKLRRIFTTISYNIVLRMTV 351
gi 1730876    412 KNIQDIRT-KEISKVRKMQLSRNFLIAMAMSLPS-IASLVTFLAMYk-VNKGGRQPGNIFASLSLFQVLSLQM 481
gi 1170904    434 ARIQDARS-RELRCLRDVHVANVFFMFVNDATPT-LVIAVVFILYH--VSGKVLKPEVVFPTIALLNTMRVSF 502
gi 1711613    520 SRVEVTRR-KEMTSLRAFAVYTSISIFMNTAIPI-AAVLITFVGHVsfFKESDLSPSVAFASLSLFHILVTPL 590
gi 296439301  526 DKVLAIRQ-EELKVLKKSAYLSAVGTFTWVCTPF-LVALCTFAVYVtiDENNILDAQTAFVSLALFNILRFPL 596
gi 6920083    508 EKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPF-LVSCCTFAVFVy-TEDRALTTDLVFPALTLFNLLSFPL 578
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D