NCBI CDD Logo
?
pfam00305: Lipoxygenase 
Click on image for an interactive view with Cn3D
Lipoxygenase
Statistics
?
PSSM-Id: 249757
View PSSM: pfam00305
Aligned: 16 rows
Threshold Bit Score: 705.355
Threshold Setting Gi: 198443243
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
pfam00305 is a member of the superfamily cl09510.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IUK_B      181 PAPLLKYRKEEFEVLRG---DGTGKRKDFDRIYDYDVYNDLGNPDGGD--PRPILGGCSIYPYPLRVRTGRERTRTDPNS 255
gi 73920227 232 PAGLRSYRKNDLQQKRG---DGTGEREADDRVYDYDVYNDLGNPDSNGdlARPVLGGNKQFPYPRRCRTGRPPSKKDPKS 308
gi 126409   181 PASLVKYRKEELENLRG---DGTGERKEYDRIYDYAVYNDLGNPDKNKnlARTTLGGSSDFPYPRRGRTGRKSTRKDPKC 257
3O8Y_B      142 IHILKQHRRKELETRQ--------------KQYRWMEWNP------------------------------GFPLSIDAKC 177
3D3L_B          --------------------------------------------------------------------------------
gi 400195   122 QGLFRKHREEELEERR--------------SLYRWGNWKD------------------------------GSILNVAAAS 157
gi 585421   209 PEPLKKYRKEELETLQGknrEEVGEFTKFERIYDYDVYNDVGDPDNDPelARPVIGG-LTHPYPRRCKTGRKPCETDPSS 287
gi 547867   171 PATLLKYREEELVSLRG---TGEGELKEWDRVYDYAYYNDLGVPPKN---PRPVLGGTQEYPYPRRGRTGRKPTKEDPQT 244
gi 585417   170 PELLRKYRENELLTLRG---DGTGKREAWDRIYDYDIYNDLGNPDQGKenVRTTLGGSAEYPYPRRGRTGRPPTRTDPKS 246
gi 585420   168 PQPLRKYRENELVALRG---DGTGKLEEWDRVYDYACYNDLGEPDKGEeyARPILGGSSEYPYPRRGRTGREPTKADPNC 244
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IUK_B      256 EKP------GEVYVPRDENFGHLKSSDFLTYGIKSLSHDVIPLFKSAifqLRVTSSEFESFEDVRSLYEGGIKLP----T 325
gi 73920227 309 ETRk-----GNVYVPRDEEFSPEKEDYFLRKTVGSVLQAAVPAAQSLlldKLKWNLPFPSFFVIDKLFEDGVELPgvdkL 383
gi 126409   258 EIPt-----SDTYIPRDENFGHLKSGDFLTYAIKSLTQNVLPTFQKAf-gFN---NEFDTFEDVRGLFEGGLYLP----T 324
3O8Y_B      178 HKD----------LPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHM------FQSSWNDFADFEKIFVKI--------- 232
3D3L_B        1 --------mhhhhhhssgvdlgtENLDFEWTLKAGALEMALKRVYTL-------LSSWNCLEDFDQIFWGQ--------- 56
gi 400195   158 ISD----------LPVDQRFREDKRIEFEASQVIGVMDTVVNFPINT-------VTCWKSLDDFNCVFKSG--------- 211
gi 585421   288 EQRy----gGEFYVPRDEEFSTAKGTSFTGKAVLAALPSIFPQIESV---LLSPQEPFPHFKAIQNLFEEGIQLP----- 355
gi 547867   245 ESRlpitssLDIYVPRDERFGHLKMSDFLAYALKAIAQFIQPALEAV---FDDTPKEFDSFEDVLKIYEEGIDLPnqalI 321
gi 585417   247 ESRiplilsLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHAL---FDGTPNEFDSFEDVLRLYEGGIKLPqgplF 323
gi 585420   245 ESRnplpmsLDIYVPRDERFGHVKKSDFLTSSLKSSLQTLLPAFKAL---CDNTPNEFNSFADVLNLYEGGIKLPegpwL 321
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IUK_B      326 DILSQISPlPALKEIFRTDGEN---VLQFPPPHVAKVSKSGVMTDEEFAREVIAGVNPNVIRRLQEFPPKSTLDPTLYGD 402
gi 73920227 384 NFLESVVP-RLLEHLRDTPAEK---ILRFETPANIQKDKFAWLRDEEFARETLAGINPYAIELVREFPLKSKLDPAVYGP 459
gi 126409   325 DVISKISPiPVLKEILRTDGEQ---VLKFPPPHVIRVTKSAWMTDEEFGREMLAGVNPCLIQRLQEFPPKSKLDVTVYGD 401
3O8Y_B      233 ------------------------------SNTISERVMNHWQEDLMFGYQFLNGANPVLIRRCTELPEKL--------- 273
3D3L_B       57 ------------------------------KSALAEKVRQCWQDDELFSYQFLNGANPMLLRRSTSLPSRLVL------- 99
gi 400195   212 ------------------------------HTKMAERVRNSWKEDAFFGYQFLNGANPMVLKRSTCLPARLVF------- 254
gi 585421   356 ---KDAGLlPLLPRIIKALGEAqddILQFDAPVLINRDRFSWLRDDEFARQTLAGLNPYSIQLVEEWPLISKLDPAVYGD 432
gi 547867   322 DSIVKNIPlEMLKEIFRTDGQK---FLKFPVPQVIKEDKTAWRTDEEFAREMLAGLNPVVIQLLKEFPPKSKLDSESYGN 398
gi 585417   324 KALTAAIPlEMIRELLRTDGEG---ILRFPTPLVIKDSKTAWRTDEEFAREMLAGVNPVIISRLQEFPPKSKLDPEAYGN 400
gi 585420   322 KAITDNISsEILKDILQTDGQG---LLKYPTPQVIQGDKTAWRTDEEFGREMLAGSNPVLISRLQEFPPKSKLDPTIYGN 398
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IUK_B      403 QTSTITKEQLEINMGG-VTVEEALSTQRLFILDYQDAFIPYLTRINSlPTAKAYATRTILFLKDDGTLKPLAIEL-SKPH 480
gi 73920227 460 AESAITADLLEEQMRRvMTVEEAISQKRLFMLDFHDLFLPYVHKIRSlDHTTMYGSRTVFFLTDDGTLQLLAIEL-TRPA 538
gi 126409   402 QTSTMTKEHLEINLGG-LTVEEALHGNRLFILDHHDAFIPYLERINDlPTAKCYATRTILFLKDDNTLKPLAIEL-SLPN 479
3O8Y_B      274 ---PVTTEMVECSLERqLSLEQEVQQGNIFIVDFELLDGIDANKTDPcTLQFLAAPICLLYKNLANKIVPIAIQLnQIPG 350
3D3L_B      100 ---PSGMEELRAQLEK------ELQNGSLFEADFILLDGIPANVIRG-EKQYLAAPLVMLKMEPNGKLQPMVIQI-QPPN 168
gi 400195   255 ---PPGMEKLQAQLNK------ELQKGTLFEADFFLLDGIKANVILC-SQQYLAAPLVMLKLMPDGQLLPIAIQL-ELPK 323
gi 585421   433 PTSLITWEIVEREVKGnMTVDEALKNKRLFVLDYHDLLLPYVNKVRElNNTTLYASRTLFFLSDDSTLRPVAIEL-TCPP 511
gi 547867   399 QNSTITKSHIEHNLDG-LTVEEALEKERLFILDHHDTLMPYLGRVNT-TTTKTYASRTLLFLKDDGTLKPLVIEL-SLPH 475
gi 585417   401 QNSTITAEHIEDKLDG-LTVDEAMNNNKLFILNHHDVIIPYLRRINT-TITKAYASRTLLFLQDNGSLKPLAIEL-SFPH 477
gi 585420   399 QNSTITTEHVQDKLNG-LTVNEAIKSNRLFILNHHDIVMPLLRKINMsANTKAYASRTLLFLQDDRTLKPLAIEL-SLPH 476
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IUK_B      481 PDGDnlGPESIVVLPATEGVDSTIWLLAKAHVIVNDSGYHQLVSHWLNTHAVMEPFAIATNRHLSVLHPIYKLLYPHYRD 560
gi 73920227 539 SPSQ--PQWRQVFTPSTDATMSWLWRMAKAHVRAHDAGHHELITHWLRTHCAVEPYIIAANRQLSEMHPIYQLLRPHFRY 616
gi 126409   480 PGGK--GANSRVILPADGGAESTIWLLAKAYVVVNDSCYHQLMSHWLNTHAVMEPFVIATNRHLSVLHPIYKLLLPHYRD 557
3O8Y_B      351 DENP-------IFLPS-DAKYD--WLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRF 420
3D3L_B      169 PSSP----TPTLFLPS-DPPLA--WLLAKSWVRNSDFQLHEIQYHLLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRY 241
gi 400195   324 TGST----PPPIFTPS-DPPMD--WLLAKCWVRSSDLQLHELQAHLLRGHLMAELFAVATMRCLPSVHPVFKLLVPHLLY 396
gi 585421   512 NINK--PQWKQVFTPGYDATSCWLWNLAKTHAISHDAGYHQLISHWLRTHACTEPYIIAANRQLSAMHPIYRLLHPHFRY 589
gi 547867   476 PNGDkfGAVSEVYTPG-EGVYDSLWQLAKAFVGVNDSGNHQLISHWMQTHASIEPFVIATNRQLSVLHPVFKLLEPHFRD 554
gi 585417   478 PDGDqfGVTSKVYTPSDQGVESSIWQLAKAYVAVNDVGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLYPHFRD 557
gi 585420   477 PDGDqfGTVSKVYTPADQGVEGSIWQFAKAYVAVNDMGIHQLISHWLNTHAVIEPFVVATNRHLSVLHPIHKLLHPHFRN 556
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IUK_B      561 TININGLARQSLINADGIIEKSFLPGKYS-IEMSSSVYKN-WVFTHQALPADLVKRGLAIEDPSAPHGLRLVIEDYPYAV 638
gi 73920227 617 TMRINARARSALISAGGIIERSFSPQKYS-MELSSVAYDKlWRFDTEALPADLVRRGMAEEDPTAEHGLKLAIEDYPFAN 695
gi 126409   558 TMNINALARQSLINAGGVIERSFLPGEFA-VEMSSAVYKS-WVFTDQALPADLIKRGMAVEDPSSPYGLRLVVEDYPYAV 635
3O8Y_B      421 TIAINTKAREQLICECGLFDKANATGGGGhVQMVQRAMKD-LTYASLCFPEAIKARGMES---------KEDIPYYFYRD 490
3D3L_B      242 TMEINTRARTQLISDGGIFDKAVSTGGGGhVQLLRRAAAQ-LTYCSLCPPDDLADRGL------------LGLPGALYAH 308
gi 400195   397 TMEINVRARSDLISERGFFDKAMSTGGGGhLDLLKQAGAF-LTYCSLCPPDDLAERGL------------LDIETCFYAK 463
gi 585421   590 TMEINARARQSLVNGGGIIETCFWPGKYA-LELSSAVYGKlWRFDQEGLPADLIKRGLAEEDKTAEHGVRLTIPDYPFAN 668
gi 547867   555 TMNINALARQILINGGGIFEITVFPSKYA-MEMSSFIYKNhWTFPDQALPAELKKRGMAVEDPEAPHGLRLRIKDYPYAV 633
gi 585417   558 TMNINASARQLLVNAGGVLESTVFQSKFA-MEMSAVVYKD-WVFPDQALPADLVKRGVAVEDSSSPHGVRLLIEDYPYAV 635
gi 585420   557 TMNINALARETLTYDGG-FETSLFPAKYS-MEMSAAAYKD-WVFPEQALPADLLKRGVAVEDLSSPHGIRLLILDYPYAV 633
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IUK_B      639 DGLEIWDAIKTWVHEYVSLYYPTDAAVQQDTELQAWWKEAVEKGHGDLKEKPWWPKKQTTEDLIQSCSIIVWTASALHAA 718
gi 73920227 696 DGLLIWDAIKTWVQAYVARFYPDADSVAGDEELQAFWTEVRTKGHGDKKDAPWWPKLDSPESLAHTLTTIVWVAAAHHAA 775
gi 126409   636 DGLEIWDTIQTWVKDYVSLYYPTNDAVKKDTELQAWWKEAVEKGHGDLKDKPWWPKLNTPQDLIHTCSIIIWIASALHAA 715
3O8Y_B      491 DGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAA 570
3D3L_B      309 DALRLWEIIARYVEGIVHLFYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAA 388
gi 400195   464 DALRLWQIMNRYVVGMFNLHYKTDKAVQDDYELQSWCREITDIGLQGAQDRGFPTSLQSRAQACYFITMCIFTCTAQHSS 543
gi 585421   669 DGLILWDAIKEWVTDYVKHYYPDEELITSDEELQGWWSEVRNIGHGDKKDEPWWPVLKTQDDLIGVVTTIAWVTSGHHAA 748
gi 547867   634 DGLEVWYAIESWVRDYIFLFYKIEEDIQTDTELQAWWKEVREEGHGDKKSEPWWPKMQTREELVESCTIIIWVASALHAA 713
gi 585417   636 DGLEIWSAIKSWVTDYCSFYYGSDEEILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAA 715
gi 585420   634 DGLEIWAAIKSWVTEYCKFYYKSDETVEKDTELQAWWKELREEGHGDKKDEAWWPKLQTRQELRDCCTIIIWIASALHAA 713
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IUK_B      719 VNFGQYPYGGLILNRPTLARRFIPAEGTPE---YDEMVKNPQKAYLRTITPKFETLIDLSVIEILSRHASDEIYLGERET 795
gi 73920227 776 VNFGQYDFGGYFPNRPSIARTVMPVEEPVDgaaMERFLDNPDQALRECFPSQVQATVVMAVLDVLSSHSTDEEYLGGEQT 855
gi 126409   716 VNFGQYPYGGFILNRPTITRRLLPEPGTKE---YGELTSNYQKAYLRTITGKVEAIVDLSVIEILSRHASDEVYLGQRDN 792
3O8Y_B      571 VNFGQYDWASWIPNAPPTMR--APPPTAKGvvtIEQI--------VDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPE 640
3D3L_B      389 INQGQLDWYAWVPNAPCTMR--MPPPTTKEdvtMATV--------MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKE 458
gi 400195   544 VHLGQLDWFYWVPNAPCTMR--LPPPTTKEa-tMEKL--------MATLPNPNQSTLQINVVWLLGRRQAVMVPLGQHSE 612
gi 585421   749 VNFGQYGYGGYFPNRPTTTRIRMPTEDPTDe-aLKEFYESPEKVLLKTYPSQKQATLVMVTLDLLSTHSPDEEYIGEQQE 827
gi 547867   714 VNFGQYPVAGYLPNRPTISRQYMPKENTPE---FEELEKNPDKVFLKTITAQLQTLLGISLIEILSTHSSDEVYLGQRDS 790
gi 585417   716 VNFGQYPYAGYLPNRPTVSRRFMPEPGTPE---YEELKRNPDKAFLKTITAQLQTLLGVSLVEILSRHTTDEIYLGQRES 792
gi 585420   714 LHFGLYSYAGYLPNRPTLSCNLMPEPGSVE---YEELKTNPDKVFLKTFVPQLQSLLEISIFEVSSRHASDEVYLGQRDS 790
                       650       660       670       680       690
                ....*....|....*....|....*....|....*....|....*....|...
2IUK_B      796 PNWTTDKKALEAFKRFGSKLTGIEGKINARNSDPSLRNRTGPVQLPYTLLHRS 848
gi 73920227 856 RPWNSDAAVQAAYDGFAARLKEIEGVIDGRNKDRKLKNRCGAGILPYQLMKPF 908
gi 126409   793 PNWTNNIKALQAFKRFGQKLKEIEEKIMGRNKDSSLRNRNGPVKMPYTVLLPT 845
3O8Y_B      641 EH-FIEKPVKEAMARFRKNLEAIVSVIAERNENLQL---------PYYYLSPD 683
3D3L_B      459 KY-FSGPKPKAVLNQFRTDLEKLEKEITARNEQLDW---------PYEYLKPS 501
gi 400195   613 EH-FPNPEAKAVLKKFREELAALDKEIEIRNKSLDI---------PYEYLRPS 655
gi 585421   828 ASWANEPVINAAFERFKGKLQYLEGVIDERNVNITLKNRAGAGVVKYELLKPT 880
gi 547867   791 KEWAAEKEALEAFEKFGEKVKEIEKNIDERNDDETLKNRTGLVKMPYTLLFPS 843
gi 585417   793 PEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTLLFPT 845
gi 585420   791 IEWTKDKEPLVAFERFGKMLSDIENRIMIMNSHKSWKNRSGPVNVPYTLLFPT 843
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D