NCBI CDD Logo
?
pfam00135: COesterase 
Click on image for an interactive view with Cn3D
Carboxylesterase family
Statistics
?
PSSM-Id: 249618
View PSSM: pfam00135
Aligned: 123 rows
Threshold Bit Score: 291.555
Threshold Setting Gi: 68067456
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
pfam00135 is a member of the superfamily cl19094.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BIW_C          4 QKLddvdpl---------vttnfGKIRGikkeLNNeilgpviQFLGVPYAAPPTgehRFQPPEP-PSPWSDIRNATQFAP 73
gi 74933936    26 AQQthik-------------leqGDLIGlkvfPDGtrg-avyAFLGIPYAQAPInelRFAPAKP-SSSFNRTLQATTMQP 90
gi 75021753    21 LATvdqltv---------cppsvGCLKGtnlqGYQser--feAFMGIPYALPPIgdlRFSNPKV-MPKLLGMYDASAPKM 88
gi 68067570    18 LESeadpli---------veitnGKIRG----KDNgl---yySYESIPNAEHPTgalRFEAPQPySHHWTDVFNATQSPV 81
gi 308153601   22 SVTlldpll---------ieipnGKLRG----RDNgh---yySYEAIPYAEPPTgelRFEVPKPyKQQWTNTFDATQPPV 85
gi 60416432    18 SASdpadpl--------lvdlpnGKLRG----RDNgn---yySYESLPYAEPPVgdlRFEAPQPyKQQWTDTFDATQPPV 82
gi 75027264    35 DASetatvtv-------elyngqGTVLGnyayTAWtdr-afmQFRGIPFAEPPIeelRFRPPVA-RSPWTGTLNALNFGQ 105
gi 74948179    19 VESrvrgrqydeekdtivelptlGSIQGkileTAWtkr-evlQFVDVRYAEPPTglhRFKAPRP-IEPWEDVMDATAEKI 96
gi 44888974    51 ETRyaqpqea------vvqapevGQILGisghKTIanr-pvnAFLGIRYGTVGGglaRFQAAQP-I-GYQGRVNATVQSP 121
gi 74948178    75 VFTttv--------------pdlGRLRGrtltTDWtgq-kimQFLDIPYGK-AE---RFRPAEP-APSWKGVLPAHRPHA 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BIW_C         74 VCPQNIIDGrlpevmlpvwFTNNLDvvssyvqdQSEDCLYLNIYVPTEDdirdsggPKPVMVYIHGGSYMEGTG--NLYD 151
gi 74933936    91 LCPQLANTIyd------esSDGSMPrs----vsTDEDCLYLNIWTPESGmr---ygKLPIVVIVTGEEFAYDWP--RNRI 155
gi 75021753    89 DCIQKNYLL----------PTPVVY--------GDEDCLYLNVYRPEIRks-----aLPVMVYIHGGGFFGGSAgpGVTG 145
gi 68067570    82 ECMQWNQFIn--------eNNKLMG---------DEDCLTVSIYKPKKPnr----sSFPVVVLLHGGAFMFGSG--SIYG 138
gi 308153601   86 LCMQWNQFIn--------gTNKLLG---------VEDCLTVSVYRPKNSsr----nNFPVVANLHGGAFMFGGP--SQYG 142
gi 60416432    83 LCMQWDQFIq--------gDDKLAG---------NEDCLTVSVYKPKNSsr----nSFPVVAQIHGGAFMFGGA--SQNG 139
gi 75027264   106 RCPVITNLd---------sQMSDA---------ELEDCLTLSVYT-KNLsa-----sQPVMFYIYGGGFYNGSS---EDH 158
gi 74948179    97 GCPS-VVsmds-----lrrLDDVLD---------VEDCLTMTITTP-NVts-----rLPVLVYIHGEYLYEGS---NSEA 152
gi 44888974   122 NCAQFPELDrl-------rLSESRGe-------NVDDCLTLDIYAPEGAn------qLPVLVFVHGEMLFDGGS---EEA 178
gi 74948178   135 GCPSIQDLIvfa----kleEDGFD----------VEDCLRLSVNTKAMEgk-----sLPVMVYIHGDFFYDGDS---VEA 192
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BIW_C        152 GSVLASYGNVIVITVNYRLGVLGFLSTGDQAA--KGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVNLLT 229
gi 74933936   156 NGLDLAGEGIVVVSVQYRNNIYGWLSLGEQHrnvpGNYGLSDVQMALRWIRRNADAFGGNPDHITLLGHGSGGAPLALVA 235
gi 75021753   146 PEYFMDSGEVILVTMAYRLGPFGFLSTQDAVM--SGNFGLKDQNLALRWVQRNIRFFGGDPQRVTIFGQSAGGVAAHMHL 223
gi 68067570   139 HDSIMREGTLLVVKISFGLGPLGFASTGDRHL--PGNYGLKDQRLALQWIKKNIAHFGGMPDNIVLIGHSAGGASAHLQL 216
gi 308153601  143 HENIMREGSVILVTIGYRLGPLGFVSTGDADL--SGNFGLKDQRLALLWIKQNIASFGGEPENILVVGHSAGGASVHLQM 220
gi 60416432   140 HENFMREGNLILVKISYRLGPLGFVSTGDADL--SGNFGLKDQRLALLWIKQNIASFGGEPENILVIGHSAGGGSVHLQV 217
gi 75027264   159 PPNYLLEKDVVLVVPQYRVGALGWLSTYTEEL--PGNAPIADILMALDWVQMHISSFGGDPQKVTIFGQSAGAGVASSLL 236
gi 74948179   153 PPDYLLEKDVVLVTPQYRLGPFGFLSTKTDEI--PGNAGFLDIFLALQFVKHFIKYFGGDPSRVTVAGQVGGAAIAHLLT 230
gi 44888974   179 QPDYVLEKDVLLVSINYRLAPFGFLSALTDEL--PGNVALSDLQLALEWLQRNVVHFGGNAGQVTLVGQAGGATLAHALS 256
gi 74948178   193 APGYLLEHDVVLVSVRYRLGPFGFLSTLTDEM--PGNAAVTDIILALKWVQQHIASFGGDPQRVTLFGQVGGAALVNVLT 270
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BIW_C        230 LShyseKGLFQRAIAQSGTALSSWAVSFQP--AKYARILATKVGCNVSDTV-------ELVECLQKKPYKELVDQDV--Q 298
gi 74933936   236 TLed-sSQVKQLVLMSPGPIMRALGQNHQKwiVETGQVLVQKLGCQFEEAQr-----rQLMGCLRRKSREDLLRAYE--S 307
gi 75021753   224 LSpr-sHGLFHRVISMSGTANVPFAIAEQP--LEQARLLAEFADVPDARNLst----vKLTKALRRINATKLLNAGDglK 296
gi 68067570   217 LHed-fKHLAKGAISVSGNALDPWVIQQGG--RRRAFELGRIVGCGHTNVSa------ELKDCLKSKPASDIVSAVRsfL 287
gi 308153601  221 LRed-fSKLAKAAISFSGNALDPWVIQQGL--RGRAFELGRIVGCGQASDSg------TLKKCLKSKPAIEIVSAVRsfL 291
gi 60416432   218 LRed-fSKLAKAAISFSGNALDPWVVQQGG--RGRAFELGRIVGCGQASDSv------TLKKCLKSKPASEIVSAVRnfL 288
gi 75027264   237 LSpktgDNMFKRAIVQSGSIFASWAINKDP--KAQSRRICIQLGCSGCEQHd------QLVKCIQKAKVIDILKATAseS 308
gi 74948179   231 LSpvvqRGLFHQVIYHSGSAIMPIFLEEDP--RKHAQEIAKKADCKMVTVR-------DLNTCLMELTALELLTAFMe-H 300
gi 44888974   257 LSgr-aGNLFQQLILQSGTALNPYLIDNQP--LDTLSTFARLARCPPPSINpsaqglkPLYDCLARLPTSQLVAAFEq-L 332
gi 74948178   271 LSpavpAGLFHRVIYQSGTALSPAFITDAP--LGATKAIGRIAGCKQSTKVd------QLNKCLNRLNATMLLAAFS--V 340
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BIW_C        299 PARYHIAFGp--------VIDGD-----VIPDDPQILMEQgefLNYDIML-GVNQGEGLKFVENIVDSDDG---V-SASD 360
gi 74933936   308 VYNHGNGSS----------QLGV-----ILPEGLPLEQRLrnkTLPPVLL-GITSNEGAFLQDYWLDVAREgqvAlHKYI 371
gi 75021753   297 YWDVDHMTNfr------pVVEEGlevdaFLNAHPMDMLAQgmpTSIPLLL-GTVPGEGAVRVVNILGNETL-----RQSF 364
gi 68067570   288 VFSYVPFSAfg------pVVEPSdapdaFLTEDPRAVIKSgkfAQVPWAV-TYTTEDGGYNAAQLLERNKLtgeSwIDLL 360
gi 308153601  292 VFSYVPFTPfg------pAIESPdapeaFITQHPIDIIKSgkfSQVPWAV-TYTTEDGGYNAALLLEKQASsgrElIVDL 364
gi 60416432   289 VFAYVPFTPfg------pVVESPdapeaFISQHPVDIIKSgkfAQVPWAV-TYTTEDGGYNAALLLEKQASsgrElIVDL 361
gi 75027264   309 FSPIVGDLH----------GILP-----QQPSELVKSYRR----QIPILT-GFTQHDGSFVLASYYDALAAkvaNvSSLS 368
gi 74948179   301 ALEKSDLGIghtg-giqfTIGGPs---gVLPKHPYDLMLE---TNFSYPAmGGCPKNAGSRVLNEIVDNDFe-gKiPDDE 372
gi 44888974   333 LLQNEHLGLtqlg-gfklVVGDPl---gFLPSHPASLATNs-sLALPMII-GATKDASAFIVSRIYDQLARl-qSrNVSD 405
gi 74948178   341 HGENQPSLSggayggvqlVIGGPs---gILPEHPGRLLAAekfQAYPTMG-GSVKHGGTFMLRDIFADIFN---EtILDD 413
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BIW_C        361 FDF--AVSNFVDNLYGYPEGKdv-----lRETIKFMYTDWadrhnpETRr-kTLLALFTDHQWVAP-AVATADLHSNFGS 431
gi 74933936   372 NHTl-LPNVMRALES-VGEESst-----qLAAIRWRYFNGkg--egVSHllaGMQRLLSESLYELP--YSRILELLNGTT 440
gi 75021753   365 NLR--FDELLQELLEFPASFSqdrr-ekmMDLLVEVYFQGqhe-vnELTv-qGFMNLISDRGFKQPlYNTIHKNVCHTPN 439
gi 68067570   361 NDR--WFDWAPYLLFYRDAKKtikdmddlSFDLRQQYLADrr--fsVESy-wNVQRMFTDVLFKNSvPSAIDLHRKYGKS 435
gi 308153601  365 NDR--WFDWAPYLLFYRDSMTtikdmddySRKLRQEYLGDrr--fsVESy-wDVQRMFTDLLFKNSvTVSVDLHRKYGKS 439
gi 60416432   362 NDR--WFDWAPYLLFYRDSMTtikdmddySRKLRQEYLGDrr--fsVESy-wDLQRLFTDVLFKNStEISLDLHRKHGKS 436
gi 75027264   369 VRQ--FSQGINDLVNDTSGLTdn-----iLNRLLFKPQALnshdhsAAVs--SYFDLTTNIFMKSPvITLATKMYTQQRS 439
gi 74948179   373 YNT--YNYIDHVIRQTVGTDKtmlltsfvTHDFFNRNLMEngt-fdTLIp--RLIDVAGTLNHKLPvLLALNMNNKHNPD 447
gi 44888974   406 YIDvvLRHTAPPSEHRLWK----------QWALREIFTPIqeqtasLQTvapGLLELSNYILYRAP--VINSISQSYRSV 473
gi 74948178   414 TMT--GRQYIDTIIEQANGADpsgswkefSDEEIFTQNDVkngtfkRLTp--GLIDLCSTISLKNPvLLVLQANAKKLPN 489
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BIW_C        432 PT-YFYAFYHHCQ--------TDQVPAWADAAHGDEVPYVLGIPMIGPtELfpcn---------fskNDVMLS-AVVMTY 492
gi 74933936   441 S--YAYVFDHSHSmd-----mRGRRNLFGGASHSSDLPLLLGPSLFQQiARrrf-----------sgEEEQLC-RKIRGA 501
gi 75021753   440 PV-YLYSFNYQGPlsyasaytSANVTGKYGVVHCDDLLYLFRSPLLFPdFQr--------------nSTEAKViHSFVDY 504
gi 68067570   436 PV-YSFVYDNPTDsgvgqllsNRTDVHFGT-VHGDDFFLIFNTAAYRTgIRp--------------dEEVIS--KKFIGM 497
gi 308153601  440 PV-YAFVYDNPSEvgvg-qilSGRNDVYFGTVHGDDVFLIFNVSFVPA-NRr--------------pDEEIIS-RNFIKM 501
gi 60416432   437 PV-YAFVYDNPANtgigqglaKRTDINFGT-VHGDDYFLIFENIVREPqLRs--------------dEEIIS--RNFLKM 498
gi 75027264   440 TPvYVYSFEYEGTy-------TRFGYEFGN-SHYPFNGGVHHSNDNIYlFAthp-----------leGQDTQMsQKMVDV 500
gi 74948179   448 NT-FLYSFDYAGEf---------NRYKEM--DEETNLQSPFKAGVSLTdEAlylfpypehvtrlsrpDQSMA--HRMVEL 513
gi 44888974   474 PA-YLYTFDYRGEhhrfghlsNPLPFGVDA-SLSDDSVYLFPYPPEASrLNp--------------lDRSLS--RALVTM 535
gi 74948178   490 ST-YLYSFDYEGE---------QNRYATGE-DEANFVPFDMGVSLTDDnLYlfpwprf---lalnsnRDLK-VaRRMVAL 554
                         570       580       590       600       610       620
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
3BIW_C        493 WTNFAKTGDPnqpvpqdtkfihtkpnrfeevAWTRYSQkdq-lyLHIGLKPRVKEHYRANKv--NLW 556
gi 74933936   502 FANFIKNGNPtpgr--------------iydGWLPYNKe-----NPFVYSLGEQAKTPQTGs-vDEA 548
gi 75021753   505 FVHFAKFGKPrnsvl------------ltpcSIEVLQSr----pDGICDYHEFANAPDAYQgfeVHV 555
gi 68067570   498 LEDFALNDKGtltf--------------gecNFQNNVNs-----KEYQVLRISRNACKNEEy-aRFP 544
gi 308153601  502 LEYFALSTDDtmay--------------gdcVFQNNVGs-----KHMQLLSITRDGCENKQl--NCF 547
gi 60416432   499 LNDFVLSENGtlaf--------------gtcVFQDNVGs-----SKLQLLSITRNGCENLEl--ESF 544
gi 75027264   501 WTSFAIEGVPr--------------------NLSPLSSasgpynKLNLEVTKGDDLLDTLT---AAI 544
gi 74948179   514 WTNFVISGNPlgsa--------------rvgYWPPMTTlyg-pyMRIDDTMTIGGNYFTEF---SAT 562
gi 44888974   536 WVNFATTGVPnps----------------sgVWPQATSe----yGPFLRFTNNQQSPLELDp--HFG 580
gi 74948178   555 WTSFATTGVPqap---------------glpAWPAMNDe----tGPYMKIDRTVSFGDNYLd--EYR 600
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D