NCBI CDD Logo
?
pfam00022: Actin 
Click on image for an interactive view with Cn3D
Actin
Statistics
?
PSSM-Id: 249516
View PSSM: pfam00022
Aligned: 30 rows
Threshold Bit Score: 348.443
Threshold Setting Gi: 27923739
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam00022 is classified as a model that may span more than one domain.
pfam00022 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1IJJ_A        5 DETTALVCDNGSGLVKAGFAGDDAPR----------AVFPSIVG-----RPRHQgvmvg-------mgqkDSYVGDE--- 59
gi 27923739  11 GEKTAVVIDLGEAFTKCGFAGETGPR----------CIIPSVIKragmpKPVRVv---------------QYNINTE--- 62
gi 75035327  23 LHTNAAVLDMGSHTTRLGFAGDTVPR----------MRQRTCVV-----KGKGTfsda---------cdvLDHVDDPa-a 77
gi 75285838   3 GGSGVVVLDNGGGLLKAGFGGDMNPT----------AVVPNCMA-----KPPGSk---------------KWLVADQl-q 51
gi 74666235  20 LPEKTFIIDNGAYTLKAGYAPGFPPPedlgqalsacSTIPNAIA-----KTRGN----------------RIYIGAQlns 78
gi 74616231  17 PPTTTLVLDNGADTIKAGFVSDDKSDgk-------pRIIPNCLA-----RDRHR----------------KIYVGSEl-e 67
gi 75030748   6 ASIQSVVVDVGTRNTRVGFSGEEAPR----------TMLRSCVGlpgtrRPRPTll------------qhPFDIATG--- 60
gi 74894039   6 ERAPVVILDGGSHHLRAGYASDGAPR----------LDIPALVG-----HPRNRgvava-------agmnEYEIGDV--- 60
gi 74659622  18 DEVTSIVIECGSSYTRVGFSGDDLPK----------VVIPTKYG-----KYTNDkg------------edVYEFGLE--- 67
gi 74659616  14 DEVATLVIDTGSSYTRVGYAGEDTPK----------LVVSTECG-----LMADEdvemeddtsnttkklnKYKVGDS--- 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1IJJ_A       60 AQSk--RGILTLKYPI-EHGIITNWDDMEKIWHHTFYNE-LRVA--------P-EEHPTLLTEAPLNPKANREKMTQIMF 126
gi 27923739  63 ----------------------ELYSYLKEFIHILYFRH-LLVN--------P-RDRRVVIIESVLCPSHFRETLTRVLF 110
gi 75035327  78 ATT------------VlENGVIVDWEGYEELLSRVARILdLENV--------E-NSTPLLVTEKALVPTHQRQKIAEVLF 136
gi 75285838  52 AQDv-dVTGMTLRRPI-DRGYLINQEVQREVWERVIRNL-LQVD--------P-NNSSLLLVEPQFNPPALQHATDELVF 119
gi 74666235  79 QVTd--WNEMVFRRPV-EKGYIVNWEAQKEIWDNAFFDE-KTVRskdlriesP-EDTTLVLTEAPNALPTLQKNADEIVM 153
gi 74616231  68 KCKd--FSELAFRRPV-EKGFIVNWEAQKEIWDREFFDD-KAAQkc-----dP-SDTRLILTEQPNSLPSLQTHCDQIVF 137
gi 75030748  61 DAAyndGGLLSLTYPV-RAGHVCDYDALEKLLFYALVEE-ARVT--------P-DTSPFLFLVPADQTRLDRERLCELLF 129
gi 74894039  61 ALAk--RGMLTVSSPI-ESGRVVSWENMEKLWGHVMYSE-LRVR--------P-ESHCFIVPQSVNTPASQKEKTLELMM 127
gi 74659622  68 NVHr-pVAGKEIYSPV-QDGCIQDWDGVAKLWEYAIKEK-LKVD--------DlSEYPLVITEQMWNSSARRAKIAEMCF 136
gi 74659616  76 ANLp--LPNMEVLHPL-TDGIVADWDAVQNIWEYSLAR--LNAD--------T-KTHPLMLTEPCWNTQANKLKALEIAF 141
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1IJJ_A      127 ETFNVPAMYVAIQAVLSLYASGRT------------------TGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLT 188
gi 27923739 111 KYFEVPSVLLAPSHLMALLTLGIN------------------SAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALH 172
gi 75035327 137 ETHRVVATSFALSPVLSLYASGLG------------------TGVAVELGHDQSHVAPVFQGLSLFHATHCLDVGGADLT 198
gi 75285838 120 EELGFKSLCVADAPSLVHLYEASRqpsl----------fraqCSLVVDCGFSFTHASPVLQNFTLNYAVRRMDLGGKALT 189
gi 74666235 154 EEWGFGGYVRFVGPVLNAWNEVQSlfgdpigqdssspispkqCLLVVDSGYSHTTVTPVYKGQPIQRAIRRLDIGGKHLT 233
gi 74616231 138 EEYGFASYYRGLGPVFNAYRDIQSifrtpqs----tidspaqVILLIDSGYSHTTVTPILQGRPLHPAIRRLDVGGKLMT 213
gi 75030748 130 ESFNIPLAGLLTNTAATLYSSGRT------------------RGLALDSGAGRTCVAAVEEGYTLAHSVRSSSLAGEALT 191
gi 74894039 128 ETFHVHSLFLGASQVLSLYSYGLT------------------TGLVIDSGKDRTMAVPVHEGYALGRHVAESDVAGEKLT 189
gi 74659622 137 DKFRSPAISFVKNPLCTAYAAVRP------------------NSIIVEIGSAVASVSTVLDGNVVTKASFHSKFGGDFLN 198
gi 74659616 142 ESLEVPASYLVKDAVASAFAAGKG------------------NALVLDVGSEVASVTPVIDGLVLYKPARRSQYAGDYLD 203
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1IJJ_A      189 DYL-MKILTE-----R--------------------------------GYSFVTTAEREIVRDIKEKLCYVALDFEnem- 229
gi 27923739 173 KELeTQLLEQctvdtsv--------------------------akeqslpSVMGSVPEGVLEDIKARTCFVSDLKRgl-- 224
gi 75035327 199 RHF-TSLMSGvatthVsv------------------------------lgSMTPTQRESMWEYIKERHCTVAEDAQaf-- 245
gi 75285838 190 NYL-KELISYr---------------------------------------SLNVMDETLLIDDAKEKLCFVSLDVPgdl- 228
gi 74666235 234 NYL-KEMVSM-----R----------------------------------QYNMVDETYIMNEVKEAVCFVSNNFAgdl- 272
gi 74616231 214 NYL-TRLLSVr---------------------------------------HFDMRNEPYIVNEMKEAVCYTSLDFKgdl- 252
gi 75030748 192 DEL-FAALRAg-------------------------------------GYPLSTAADRGVVEAAKEALCRVs-------- 225
gi 74894039 190 EYF-ASLLRLe-------------------------------------GNSFGTPMEMQVLNNAKEDICYVKPPIFnmtg 231
gi 74659622 199 YLI-LEEFKR-----Kqvevipsylvkkkkdi-ndpnpstflrelpgmTDSYKNFEIERVLDNFKETTLQVNYHPImp-- 269
gi 74659616 204 RQI-KKVLVS-----RgidltprfeiknkkavemgeppvftkrelpnvTHSFTDLQVSRILSEFKDSMCQVNDVPLt--- 274
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1IJJ_A      230 --------------atAASS-----------SSLEKS------Y----ELP-DG-------------------------- 247
gi 27923739 225 --------------kiQAAKfnidgnnerpsPPPNVD------Y------PlDG-------------------------- 252
gi 75035327 246 ---------------sEISRvgigmgspssgSPPGSPhgeedrYreecVLP-DGt------------------------- 284
gi 75285838 229 -------------rlaRLSSn---------dNPFRCS------Y----ILP-DGitykkgfvkdldeacrysslpanges 275
gi 74666235 273 -------------eqtWQGNrkrgl--tdaaEGITVD------Y----VLP-DPntgkkgfmrphdplsna--------- 317
gi 74616231 253 -------------ektWKGTrgekredylsgAGIAKD------Y----VLP-DShtrfhgvvrdyep------------- 295
gi 75030748 226 ---------------aDAKDeearqvgthshPDPADG------F----ILP-DQ-------------------------- 253
gi 74894039 232 psaffspsefpgecdyDLSLegapgegfedgREDHSSde--rvF----YLP-DG-------------------------- 278
gi 74659622 270 ---------------hTPLP-----------PNIQRP------Y----EFP-DG-------------------------- 286
gi 74659616 275 ---------------pEISG-----------EAADRV------F----EFP-TG-------------------------- 291
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1IJJ_A      248 ---------------------Q--VITIGNERFRCPETL-----FQPsfiGMESA------------------------G 275
gi 27923739 253 ---------------------EkiLHILGSIRDSVVEIL-----FEQdneEQ---------------------------S 279
gi 75035327 285 -----------------------aLPISGAARFIPGECY-----FQPslsPALQQlrdqstvvde----vllrttqtpvS 332
gi 75285838 276 vrkdssdsdrskfedkkkpelSqnEFVLTNERFLVPEML-----FHPidlGMNQA------------------------G 326
gi 74666235 318 ----kkrksilsggnaealseD--VLILGNERFTVPEIL-----FTPsdiGMKQA------------------------G 362
gi 74616231 296 ---------gvsararkgivsTedVLTLRNERFVVPELL-----FNPsdiGIRQP------------------------G 337
gi 75030748 254 ---------------------E--RIFLLEHAYKVPEAL-----FDStylTYTTAlsaerpttptgysqsnpivkktlsG 305
gi 74894039 279 ---------------------N--AIPISTHRSLTTEAL-----FDFgilGSQyvpksrymtel-----geifqpsfpmG 325
gi 74659622 287 ---------------------S--TYIAEQERFGIAESLfrpveFGPpgvVPEGTl-----------------------G 320
gi 74659616 292 ---------------------Y--STTFGADRLSTSESL-----FKPseyPFDGEtvpd-----------------tarG 326
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1IJJ_A      276 IHETTYNSIMKCD--IDIRKDLYANNVMSGGTTMYPGIADRMQKEITAl--------APSTM-----KIKIIAPP---ER 337
gi 27923739 280 VATLILDSLIQCP--IDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYlvekpkykkALGTK-----TFRIHTPPa--KA 350
gi 75035327 333 IPELVVDAMKRCD--HDLLPTFASHIVVSGGASLLRGLTQRVESDVQTc-------lASTGGihsvgSARVYADV---ER 400
gi 75285838 327 LAECIVRAIQACH--PHLQPVLFERIILTGGSTLFPRFTERLEKELRPl--------VPDDY-----QVKIIAQE---DP 388
gi 74666235 363 IPDIILQSLSVLP--TGLHPSFLANVLVVGGNTLIPGFLERLESELRQi--------ASAEC-----VVRVRRPH---DP 424
gi 74616231 338 IADLVKQSLLAVP--IGLWPGLLANIVVVGGNSLSEGFCQRLQTEILKr--------FPDEC-----RVRVARPE---DP 399
gi 75030748 306 WVGMLRDAADAAP--RILEQALYENVVLGGGSTLFPGTEQRVQREIAGi--------APKGV-----RATCVAFP---ER 367
gi 74894039 326 VSWLAFAAINNCQ--PVIRAQLYASIVLSGGNVSFPGTRERIETEVTQly-----reTHTSE-----AVTPIAVNdipCR 393
gi 74659622 321 ISELIYHAVLKTDpkAEVQMELLNNIVVVGGTTLLNGLTARIHRDMAQ---------FFTQFhvkqpYLSVTST----ER 387
gi 74659616 327 LSEMVVDTINASN--VDVRAHLANNIVITGGGSLVQGLSDRVSKDVTQ---------ALSGL-----KVRVAAASnqeER 390
                       570       580       590       600
                ....*....|....*....|....*....|....*....|..
1IJJ_A      338 KYSVWIGGSILASLS-TFQQMWITKQEYDEAGPS-IVHRKCF 377
gi 27923739 351 NCVAWLGGAIFGALQdILGSRSVSKEYYNQTG---RIPDWCS 389
gi 75035327 401 RDAAFVGGSIWASLP-AAQALWVTKADYNEVGSM-AVVRGGF 440
gi 75285838 389 ILGAWRGGSLLAHRP-DFESMCITKSEYEEMGSM-RCRRRFF 428
gi 74666235 425 IRSTWLGASRLAANRaELRKFAITRQEYQEYGSS-WAGRKFS 465
gi 74616231 400 IISTWLGAANFAKHE-HASKLEVTKQEYEEHGAA-WVARKFA 439
gi 75030748 368 GAAAWMGASIWGCSS-VFPDTCLAKATYDEQGSS-VVHLYTQ 407
gi 74894039 394 VYSAWVGGSMLAGTS-MFPHLAVSRQEYEEQGHR-VVHCKCQ 433
gi 74659622 388 KSLAWTGASVFASLG-NFGSSWVIKQEYEEQGAD-VIDKRFK 427
gi 74659616 391 RHGAWIGGSVLGSLG-SFHQLWVSKQEWQEKGGDyLVEKKRF 431
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D