Conserved Protein Domain Family
AmyAc_GlgE_like

?
cd11344: AmyAc_GlgE_like 
Click on image for an interactive view with Cn3D
Alpha amylase catalytic domain found in GlgE-like proteins
GlgE is a (1,4)-a-D-glucan:phosphate a-D-maltosyltransferase, involved in a-glucan biosynthesis in bacteria. It is also an anti-tuberculosis drug target. GlgE isoform I from Streptomyces coelicolor has the same catalytic and very similar kinetic properties to GlgE from Mycobacterium tuberculosis. GlgE from Streptomyces coelicolor forms a homodimer with each subunit comprising five domains (A, B, C, N, and S) and 2 inserts. Domain A is a catalytic alpha-amylase-type domain that along with domain N, which has a beta-sandwich fold and forms the core of the dimer interface, binds cyclodextrins. Domain A, B, and the 2 inserts define a well conserved donor pocket that binds maltose. Cyclodextrins competitively inhibit the binding of maltooligosaccharides to the S. coelicolor enzyme, indicating that the hydrophobic patch overlaps with the acceptor binding site. This is not the case in M. tuberculosis GlgE because cyclodextrins do not inhibit this enzyme, despite acceptor length specificity being conserved. Domain C is hypothesized to help stabilize domain A and could be involved in substrate binding. Domain S is a helix bundle that is inserted within the N domain and it plays a role in the dimer interface and interacts directly with domain B. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
Statistics
?
PSSM-Id: 200482
View PSSM: cd11344
Aligned: 36 rows
Threshold Bit Score: 621.16
Threshold Setting Gi: 315654828
Created: 5-Aug-2011
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
Hierarchy
?
Display:
 
Conserved site includes 16 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

cd11344 is part of a hierarchy of related CD models.
Use the graphical representation to navigate this hierarchy.
cd11344 is a member of the superfamily cl07893.
cd00551:AmyAc_familycd11313:AmyAc_arch_bac_AmyAcd11314:AmyAc_arch_bac_plant_AmyAcd11315:AmyAc_bac1_AmyAcd11316:AmyAc_bac2_AmyAcd11317:AmyAc_bac_euk_AmyAcd11318:AmyAc_bac_fung_AmyAcd11319:AmyAc_euk_AmyAcd11320:AmyAc_AmyMalt_CGTase_likecd11321:AmyAc_bac_euk_BEcd11322:AmyAc_Glg_BEcd11323:AmyAc_AGScd11324:AmyAc_Amylosucrasecd11325:AmyAc_GTHasecd11326:AmyAc_Glg_debranchcd11327:AmyAc_Glg_debranch_2cd11328:AmyAc_maltasecd11329:AmyAc_maltase-likecd11330:AmyAc_OligoGlucd11331:AmyAc_OligoGlu_likecd11332:AmyAc_OligoGlu_TScd11333:AmyAc_SI_OligoGlu_DGasecd11334:AmyAc_TreScd11335:AmyAc_MTase_Ncd11336:AmyAc_MTSasecd11337:AmyAc_CMD_likecd11338:AmyAc_CMDcd11339:AmyAc_bac_CMD_like_2cd11340:AmyAc_bac_CMD_like_3cd11341:AmyAc_Pullulanase_LD-likecd11343:AmyAc_Sucrose_phosphorylase-likecd11344:AmyAc_GlgE_likecd11345:AmyAc_SLC3A2cd11346:AmyAc_plant_IsoAcd11347:AmyAc_1cd11348:AmyAc_2cd11349:AmyAc_3cd11350:AmyAc_4cd11352:AmyAc_5cd11353:AmyAc_euk_bac_CMD_likecd11354:AmyAc_bac_CMD_likecd11355:AmyAc_Sucrose_phosphorylasecd11356:AmyAc_Sucrose_phosphorylase-like_1cd11359:AmyAc_SLC3A13ZT7 A3ZSS A324697913361051033156548282346498531498803333601838334840857835929394847714014919893826141632117191515619623328725709423610880316526992545211537817986604984182412927300114854251771523239814981320102708225872501838165942976236522584041722167489916384673486142685284039505326799588912007703372926713ZT7 A3ZSS A32469791336105103315654828234649853149880333360183833484085783592939484771401491989382614163211719151561962332872570942361088031652699254521153781798660498418241292730011485425177152323981498132010270822587250183816594297623652258404172216748991638467348614268528403950532679958891200770337292671
cd11344 Sequence Cluster
cd11344 Sequence Cluster
Sub-family Hierarchy
Click to see CD Hierarchy help
 cd11344 Branch
 Whole Hierarchy
 [Download CDTree]
CD Hierarchy
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                   #   #                
3ZT7_A       231 YGAWYEFFPRsegt------phtPHGTFRTAARRLPAIAAMGFDVVYLPPIHPIGTTHRKGRNNTLSATGDDV------G 298
3ZSS_A       231 YGAWYEFFPRsegt------phtPHGTFRTAARRLPAIAAMGFDVVYLPPIHPIGTTHRKGRNNTLSATGDDV------G 298
gi 149198938 205 FASWYEVFPRscsg------kegMHGTFRDVEKMLPYIDDLGFDVLYFTPIHPIGFSKRKGKNNSLTSAKGEP------G 272
gi 171915156 201 FSAWYEFFPRsaeg------radRHSTFRDCLARLDDAKSMGFDVIYFPPIHPIGVTHRKGKNNTLVAHPGDV------G 268
gi 257094236 200 FASWYEFFPRsqgt------vpyRHGTLQDCIRRLRAIHAMGFDVVYLPPIHPIGVSFRKGKNNSLVSIPGDV------G 267
gi 261416321 120 VGTWYEMWPKsqgt------dpkKSATWKDCEKQLDYIAGLGFDTVYLVPIHPIGVTNRKGANNALHAKVDKKgnplepG 193
gi 336105103 247 TGSWYELFPRshgawwddraqewRSGTLRTAAEQIPRIAAMGFDVLYLTPIHPIGLTNRKGRNNSLGALPGDP------G 320
gi 196233287 281 FSQWYEFFPRsaeg------rgdKGSTFRDCLPRVDDARAMGFDVIYFPPIHPIGITARKGKNNAVNCQPGEP------G 348
gi 315654828 356 AGAWYEIFPRsigayy-gsdgriVPGTLRTAAEILPEVAADGFDVIYLTPIHPIGHAFRKGRNNALMAGPHDP------G 428
gi 314988033 137 YGSWYEFFPRsqgayv-dadghwVSGTFDTSWERLDAAAAMGFDVVYLPPIHPIGTAFRKGKDNTLTPGPDDP------G 209
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        # #                                                #                            
3ZT7_A       299 VPWAIG------SPEGGHDSIHPALGTldDFDHFVTEAGKLGLEIALDFALQCSPDHPWVHKHPEWFHHRPDGTIAHAEN 372
3ZSS_A       299 VPWAIG------SPEGGHDSIHPALGTldDFDHFVTEAGKLGLEIALDFALQCSPDHPWVHKHPEWFHHRPDGTIAHAEN 372
gi 149198938 273 SPYAIG------SEAGGHFAVHPELGTmdDFDHLVKACAEKDIEIALDFALNCSPDHPYLKEHPDWFYRRPDGSIKYAEN 346
gi 171915156 269 SPWAIG------SSHGGHRAVEPALGTveDFEWLVGEARQRGLEIALDFAINCSPDHPYVKEHPGWFHQREDGSIRYAEN 342
gi 257094236 268 SPWAIG------NEHGGHMALEPQLGTwdDWDQFVATCRELEIEIALDYVMNCSPDHPYVSEHPDWFFHRPDGSFKYAEN 341
gi 261416321 194 CPYAVG------NKNGGHYDVDPELGTmkDFEHFAKTARAKGLRLALDIALNCSPDHPYVKSHPEWFYHEPDGSIKFAEN 267
gi 336105103 321 SPYAIG------SADGGHDAIEPSLGTfdDFDAFVARARDHGMEVALDIALQCSPDHPWVAEHPEWFTTRVDGSIAYAEN 394
gi 196233287 349 VPYAIGnrhqkcPNGGGHKDVAPELGTleDFGWLVKEIHARGMEVALDFALNCSPDHPYVHEHPDWFYKRPDGTIKYAEN 428
gi 315654828 429 SPWAIG------NEHGGHDAVDPALGGiaAFDEFVAEAQRNHLEVALDFALQCSPDHPWVKAHPEWFSARADGSIAYAEN 502
gi 314988033 210 SPWAIG------SSDGGHDTIHPDLGTfdDLDRFVAHAHDLGMEVALDFALQASPDHPWVHQHPEWFTTRVDGTIAYAEN 283
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           ## ##                                # ##                           #        
3ZT7_A       373 PPKKYQDIYPIAFD-ADPDGLATETVRILRHWMDHGVRIFRVDNPHTKPVAFWERVIADINGTDPDVIFLAEAFTRPAMM 451
3ZSS_A       373 PPKKYQDIYPIAFD-ADPDGLATETVRILRHWMDHGVRIFRVDNPHTKPVAFWERVIADINGTDPDVIFLAEAFTRPAMM 451
gi 149198938 347 PPKKYEDIYPLNFEcEDRKNLWAEIRDIFLFWASHGVRTFRVDNPHTKPISFWNWCIAEVHKEYEDVIFLSEAFTRPRLM 426
gi 171915156 343 PPKKYQDIYPINFHcEDWKSLWRELIDVVLFWVERGVKIFRVDNPHTKPVSFWEVLIAEVQAKDPDVIFLAEAFTKPRMM 422
gi 257094236 342 PPKKYQDVYPLNFGtSDRAGLWQEMLKIFLFWVGKGVTTFRVDNPHTKPVPFWEWVIGEVHRQHPEVIFLAEAFTKPKMM 421
gi 261416321 268 PPKKYEDIYPFDYYnENYKELWKEIENIILFWADKGVEIFRIDNPHTKPFPFWEWLIADVKEKRPELVFLAEAFTRPKMM 347
gi 336105103 395 PPKKYQDIYPLNFD-NDPDGLAREIRRVLQVWIDHGVTLFRVDNPHTKPLDFWQWLLADVARDHPEVVFLSEAFTRPAMM 473
gi 196233287 429 PPKKYQDVYPLNYHnADWRTLWDELTSVIEFWCEHGVRIFRVDNPHTKPVAFWEYLIGRVQARFPDALFLSEAFTRPKMM 508
gi 315654828 503 PPKKYQDIYPLNFD-NDPDGLYAEIRRVIEFWIDHGVTIFRMDNPHTKPVRFWQRLAADLHQTHPEVVMLAEAFTAPAMM 581
gi 314988033 284 PPKKYQDIYPINFD-NDPDGIYQECLRLLELWISHGVTIFRVDNPHTKPLNFWAWLMEQVHRRHPEVIFLAEAFTRPEMM 362
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                         #                              
3ZT7_A       452 ATLAQIGFQQSYTYFTWRNTKQELTEYLTELs-gEAASYMRPNFFANTPDILHAYLQhgGRPAFEVRAVLAATLSPTWGI 530
3ZSS_A       452 ATLAQIGFQQSYTYFTWRNTKQELTEYLTELs-gEAASYMRPNFFANTPDILHAYLQhgGRPAFEVRAVLAATLSPTWGI 530
gi 149198938 427 ELLAKNGFTQSYSYFTWREGKEELTEYFNYLhnsEAVEYMTANIFATTPDILPKHLQfsSAQMFRIRHALAVTLSPMYGM 506
gi 171915156 423 QGLGKIGFSQSYTYFTWRESKHELTEYANELtlgDMRWYYRGNFWPNTPDILPHHLQnaGAPSFKLRAALAALLVPSWGI 502
gi 257094236 422 RLLAKVGFAQSYTYFTWRNEKQELTDYVNELtsgEMKEYFTGNFFANTPDILPPILQygGRPAFIIRAVLAATLSSVYGI 501
gi 261416321 348 HRLAKSGFDMSYTYFAWRSAKWEFEQYLKELtqsDAKEYMRGIFFPTTPDIFPKYLAykGANAFKQRYFLAATLSSLTGM 427
gi 336105103 474 QTLAKVGFHQSYTYFTWRHTKEEVAEYLAEVs-gDQGAWMRPAFWPTTHDILPPYLQgaGGQAWAIRAVLAALGSPTWGI 552
gi 196233287 509 KVLAKAGFTHSYTYFTWRNTKEGLTKYFTEItqtECSEYMRPNLWPNTPDILPSFLQfgGRSAFIIRAVLAATLSPVYGI 588
gi 315654828 582 RGLAKAGFHLSYTYFTWRNTKAELTEYFEELa-yETAHVLRPALFPMTPDILTDYMTa-GVGAFKARALLAATAAPTWGI 659
gi 314988033 363 AALGKVGFQQGYSYFTWRTTKWELEAYLDEVs-hQTSHFYRPNFFVNTPDINPIYLNdgNPAGFAIRAILAATMSPSWGM 441
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                      ##                                
3ZT7_A       531 YSGy-----------------------ELCENTPLREGSEEYLDSEKYQLKPRDWTraareGTTIAPLVTRLNTIRRENP 587
3ZSS_A       531 YSGy-----------------------ELCENTPLREGSEEYLDSEKYQLKPRDWTraareGTTIAPLVTRLNTIRRENP 587
gi 149198938 507 YTG------------------------YELCENIPVGPRDELMDSEKYELKVRNYEd----SGSIAPFVKKLNMIRRENP 558
gi 171915156 503 YSG------------------------YELCENQPLAGREEYLDSEKYEVKGRDWNa----PGNIKGFIRELNRARQENR 554
gi 257094236 502 YSG------------------------YELCENQAIPGKEEYLDSEKYEIKVRDWKa----PGHIVQIITLINNIRHDSP 553
gi 261416321 428 YNG------------------------YELCENIPSPIKEELADSEKYQYKVHNWS-----GPGIQDFVRRLNVARQEHV 478
gi 336105103 553 YSG------------------------YELLENVPRPGADEQIDNEKYEFRPRDWSva--dHLGIASLLGRLNQIRREHP 606
gi 196233287 589 YSGfelcenlgldkkpwdaasnvghflHLCDNDYKQLAKEEYLDSEKYQWKQRDWNa----PGNIKEIITRLNRIRHENR 664
gi 315654828 660 LGGs-----------------------YEFCEHVQRPGVEESIDNPKYEVKVYDWAar--dKYGIASLLRTLNAARSAHP 714
gi 314988033 442 YSG------------------------FEICEHEPLPGREEYAHSEKYEYRPRDYDs----EPNITLLVTRLNEIRRAHP 493

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D
Conserved site includes 16 residues -Click on image for an interactive view with Cn3D