NCBI CDD Logo
?
cd01948: EAL 
EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.
Links
?
Statistics
?
PSSM-Id: 238923
View PSSM: cd01948
Aligned: 386 rows
Threshold Bit Score: 89.1419
Threshold Setting Gi: 46113799
Created: 12-Dec-2003
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Hierarchy
?

cd01948 is part of a hierarchy of related CD models.
Use the graphical representation to navigate this hierarchy.
cd01948 is a member of the superfamily cl00290.
cd01948:EAL4873198233597535463123615200806952008401536881275429619446113854537596672890067337676372376763929657942341014474631233253725878302485942301491313472293345571721589361445656539263223046113799156148405361147634558450455213932886746827359213212305444876597913634045298283148766271159647051559732953721824369588445012219351598118391600828897150501224701347276853727380231264674613260252007833463193934883403513471767212435391363405313638606488340302983047195522613455788434557175462016204620211438608085372768754302260336010923851549117621116765453488610795285754452853429212299595285728211766983964810352008465487809932737551348863933349482965622928898753500855061793502152857122179892494877006748770717250673114917092336020921798773142560412269901482506596136340462624807551595649249886715801017542973805430871654302506288985425402210546317493537714892890046452840328273760023767941529836222982789136340433791313648765157536920483174776434103878456589432983839645845748863019537631484877168248765661273585471347685252008125156008512735858531283062738134248783622288700861612514913473973175492723024858054031598341038153410352531238912736266227359431336016414616458246188394520099115200919352009267175481044877187328869887230145152347415737680251183099903659619365961546203172396501373455724410012814252344815964612212314062124311648832935336010934619246546192907461887331754522915596924646010548782781487721045867915402689041407444172306065806421584081246106379520066054883637344672624610436222298169100145553764926231298562312474523127911455281941652490239578083247240128868556465798251347624239647838494752431612762653795175231057102350070445916199462015364757350748783633461880492886848948833912537642333491580813475596461407044873028148765201520082113999604948847036487865895200827548846557537268282310438153764212234754004876384246202515341024575372995815600210155985076458153488337462437174146317097249559748846537487661794611947346119472165183516518345373501016518362829614520082074885116127377700134736841589036115889502520111991347302523010453175462642402128227376066273757071626329617988014396477014620191516125110488512354591537615890495461295094658083713488231537187164631316648783470462024155376038953804274461210361653584345573294873184846120990463243405429399528896866488633404467246288713502123196747573963376767644886138950120935461636782347091721231471288673542437408246113669461132374883302153729720488334614172425248863664543078231589627153612729175493185371746553691605461300524612982623112088521447654873028216534731652064494789744611367330021841475697961562053696573492889689142779774376802485430963122299542512469623057782646201519165193254292994528415872890136651244483542971252437202248860724537594424172554223015361343302924876331148832736263369622127703586690537962191754847524373074537308973410456637678200273584575606874828871763243721392886776453735933243749005429691146129843159647124757482445520956341026841223044448781153537601064877194853612436100011847572008269878902738165636596213915427487697132123131348731982335975354631236152008069520084015368812754296194461138545375966728900673376763723767639296579423410144746312332537258783024859423014913134722933455717215893614456565392632230461137991561484053611476345584504552139328867468273592132123054448765979136340452982831487662711596470515597329537218243695884450122193515981183916008288971505012247013472768537273802312646746132602520078334631939348834035134717672124353913634053136386064883403029830471955226134557884345571754620162046202114386080853727687543022603360109238515491176211167654534886107952857544528534292122995952857282117669839648103520084654878099327375513488639333494829656229288987535008550617935021528571221798924948770067487707172506731149170923360209217987731425604122699014825065961363404626248075515956492498867158010175429738054308716543025062889854254022105463174935377148928900464528403282737600237679415298362229827891363404337913136487651575369204831747764341038784565894329838396458457488630195376314848771682487656612735854713476852520081251560085127358585312830627381342487836222887008616125149134739731754927230248580540315983410381534103525312389127362662273594313360164146164582461883945200991152009193520092671754810448771873288698872301451523474157376802511830999036596193659615462031723965013734557244100128142523448159646122123140621243116488329353360109346192465461929074618873317545229155969246460105487827814877210458679154026890414074441723060658064215840812461063795200660548836373446726246104362222981691001455537649262312985623124745231279114552819416524902395780832472401288685564657982513476242396478384947524316127626537951752310571023500704459161994620153647573507487836334618804928868489488339125376423334915808134755964614070448730281487652015200821139996049488470364878658952008275488465575372682823104381537642122347540048763842462025153410245753729958156002101559850764581534883374624371741463170972495597488465374876617946119473461194721651835165183453735010165183628296145200820748851161273777001347368415890361158895025201119913473025230104531754626424021282273760662737570716263296179880143964770146201915161251104885123545915376158904954612950946580837134882315371871646313166487834704620241553760389538042744612103616535843455732948731848461209904632434054293995288968664886334044672462887135021231967475739633767676448861389501209354616367823470917212314712886735424374082461136694611323748833021537297204883346141724252488636645430782315896271536127291754931853717465536916054613005246129826231120885214476548730282165347316520644947897446113673300218414756979615620536965734928896891427797743768024854309631222995425124696230577826462015191651932542929945284158728901366512444835429712524372022488607245375944241725542230153613433029248763311488327362633696221277035866905379621917548475243730745373089734104566376782002735845756068748288717632437213928867764537359332437490054296911461298431596471247574824455209563410268412230444487811535376010648771948536124361000118475720082698789027381656365962139154274876971321231313
cd01948 Sequence Cluster
cd01948 Sequence Cluster
Sub-family Hierarchy
Click to see CD Hierarchy help
CD Hierarchy
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6580642  455 TALPAALERgeffIEYQPLVHlgdg--svrGAEALVRWLHPQHgv--lgPDRFIPLAEh---TGLIVPLGRWVLEQSVRQ 527
gi 15964705  20 VTLAKLVIE----NALQPIVEattg--avfGYESLMRGFERLGfa---sPVELLDKAEa---AGQLLALEHLINSRAVAA 87
gi 15597329  28 RRFQAALARgrvrLDWQAVRHaghpeweplYRETLLRVTAASGep--plPTQELILALe--rLGLVRLLDRCVLGTVLDR 103
gi 50122470   6 LNIDGEILRl--tAEFQPIIHlpkn--kifRYEALARFYNSEGal--tpTQQTIDKIEk---CQAIDKVTDFMFDVVCQV 76
gi 36958844  11 GGAVRAMQHgrigFSLQKINAvddp-stilYSECLGRFVEPDGtv--rtRGEFSAFPEa---SQVDLAFGPDLLGLAFEW 84
gi 50122193  30 ADYWHQCQRr---YTFQPIYRtsg---klmAIELLTSVFSPTL------PQKFISPEKy--fANIDVETRLLIIVEQLQL 95
gi 51598118  46 QSFWRQCQRr---YTFQPIYRtsg---allAIELLTAVFHPSApetrlsPEDYFSTISt--gARLDVVLEQLNMVKQWHQ 117
gi 28897150  12 TTIRSERSCvtleFLLQPIYLpkng--qtvYYEALSSVISDSGehl-nsEAFFETINDefikTVLLLQMEHFSQSNSISQ 88
gi 53721824 159 VAFRQSLRSnlsyLSFQPIVRrnsa-pavlYEQALLSIVGDDDqsg-ehPASIIAALEr---LGLARLFDYRVVHAVVAR 233
gi 48766271   9 ADLSSLGRD----VALDPVISlrsg--rviGYQAVAGPPPGGR------EEDDLLLREaieaAVWSSAIALFAAVSAGRD 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6580642  528 arvwrerygesgaagplrINVNLSPCqlt-hpgLVQDTVEILERTGVap--daLCLEVTESALIgadd--dllkPLRRLA 602
gi 15964705  88 fatlpd-------fsartLFLNFDARliggegdIVERLVSHLKRANIap--ssLCFELSERFDSskmp--dfpvLVRQLR 156
gi 15597329 104 lnae----------ptlrLACNLSRQsaa-mdaWWEAVCRWLAARPQva--rrLTLELTETAVGerva---treFIRRLR 167
gi 50122470  77 iknk----------nsmtISFNLSHLlfn-ntlYLESLYQKCLSNNVsp--qnIEIEISEKTTRqqli--dgipFLNQAK 141
gi 36958844  85 lach----------psyvLGCDISAEnma-derTCTVLYDLLSRHRAla--trMVLEVTENLRPngls--vaadLLKGAR 149
gi 50122193  96 lsqwnfr----firddlfASVNIDGM-------TLLALQNNLEAKRLiaampwIRFEMVENQGGlp------keILTKLP 158
gi 51598118 118 ifvh----------hsvlVSINIDGQv------LVAMQEDHAAKRLIdam-pyIRFELLEHVDTsl------dtPFARIA 174
gi 28897150  89 di---------------lLNVNLSSLk------DDDFIESIIKRNKSn----kYHIEVNEIDTPvrdv--kilkNIKRLQ 141
gi 53721824 234 llrt----------sdarLGCRISPRsam-ldvWWASLVDWLASHPCva--rrFTVEIPCNTPVtrra--aalaFVRKLQ 298
gi 48766271  77 qr--------------lfLGLDFGLVvrw--pdMAARLAMLLDAHGVdr--rvITLSLSERRSIldlgggsgerALDRVA 138
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6580642  603 EMGVd-------IALDDFGTGYSnl-anLRRLPVSVLKLDRSFTQSmqqfpadpvdLKIVEGIVALAHs---LDLAVTVE 671
gi 15964705 157 LAGFk-------LAIDDFGAGFSgl-klLCDQPVDYVKIDRHFVSEidkd---arkRHLVRHTVNMAHa---LGTRVIAE 222
gi 15597329 168 EHGVr-------IAIDDFGAAHNnl-dfVLDARPDVIKIDCRYTREarrs---akgAEVLRHLLALCRe---LAPCVVLE 233
gi 50122470 142 KYGFm-------ISLDDFGAGNLqi-dsLSLFNFDTIKIDRSIIDGigke---etkSQKLKVLLNKLIp---LGVNIICE 207
gi 36958844 150 AIGYr-------IAIDKFGTGNS-----RLSIPADAVKIDACFAQHrrg-----daAPILRDMVALASc---AATTVVVE 209
gi 50122193 159 EAQT--------LWLDDFGCGMAnf-ssLMLAQYDCIKVARELFILlqqs---segRTVFPALIALLSr---FCNYVVIE 223
gi 51598118 175 EADR--------LWLDDFGSGLAnf-tsFISWRYEYIKVARDLFTVlqds---eagNRLFFTLVTLMDr---YSKGVIVE 239
gi 28897150 142 KSGIy-------IILDDYYHENEvahlsLGVIDWDYIKIDKSFLLYns------gnDDCLKALIFVISp--yCKNGLIIE 206
gi 53721824 299 TLGCs-------VAVTDFDTGGCdl-efALLARPQVVKISAGALRAlp------agNSLAERLARLVRpcssFDPQIVVE 364
gi 48766271 139 GAVVqmrgavgsIALDGFGGGHAgl-alLAAVKPDYVVLDPYFVSTqaid---qtrRLFLGHLVDVAHl---LGAQVIAP 211
                       250       260       270
                ....*....|....*....|....*....|..
gi 6580642  672 GVETGAQAEQLRiLGCDTAQGWYYARPGPPDR 703
gi 15964705 223 GVETEAEFLVCRdLGCDLMQGYFIARPTTHIM 254
gi 15597329 234 GLEEDDAFARLP-TGDVYLQGNAIAPPMRVEP 264
gi 50122470 208 GVEKATDLNRLNkYHPIGIQGYIFYRPLTFSQ 239
gi 36958844 210 GIETYDQLEAARiAGATHVQGFLLSEPTLPPI 241
gi 50122193 224 GIETQEEWAIVQaSHAYAAQGYYLSRPQPFEN 255
gi 51598118 240 GVETSQEWAMVQrSDAVAAQGYYLSRPTSFDG 271
gi 28897150 207 GVETYFQNEFVK-KYNLLAQGYYYSRPKNIFK 237
gi 53721824 365 GVNDPHDLNVLEaVDAAWVQGLLQSAAVNGSR 396
gi 48766271 212 QVEHLADYHACRdAGCDLVRGPVLAKPDRDPR 243
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap