NCBI CDD Logo
?
PRK01191: rpl24p 
50S ribosomal protein L24P; Validated
Links
?
Statistics
?
PSSM-Id: 234915
View PSSM: PRK01191
Aligned: 74 rows
Threshold Bit Score: 129.251
Threshold Setting Gi: 13541167
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PRK01191 is a member of the superfamily cl00354.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 219851118   4 IASKQPRKQRKARYDATQHQRSAMLGAPLAPALREKYdGkRTLRVVTGDTVKVLRGDFIGEEGVVDGVDTRTSKIIVHGV 83
gi 229582031   1 MVSLKPSKQRRLLHTLPLHQRKKLLIAKVSDEIASQY-GiKRIRVRKGDTVRVMRGNHNGKEGKVTEINTRTGRLAIEGI 79
gi 284997905   1 MVSLKPSKQRRLLHTLPLHQRKKLLIAKVSDEIASQY-GiKRIRVRKGDTVRVMRGNHNGKEGKVTEINTRTGRLAIEGI 79
gi 238619873   1 MVSLKPSKQRRLLHTLPLHQRKKLLIAKVSDEIASQY-GiKRIRVRKGDTVRVMRGSHNGKEGKVTEINTRTGRLAIEGI 79
gi 227827702   1 MVSLKPSKQRRLLHTLPLHQRKKLLIAKVSDEIASQY-GiKRIRVRKGDTVRVMRGSHNGKEGKVTEINTRTGRLAIEGI 79
gi 229584906   1 MVSLKPSKQRRLLHTLPLHQRKKLLIAKVSDEIASQY-GiKRIRVRKGDTVRVMRGSHNGKEGKVTEINTRTGRLAIEGI 79
gi 227830398   1 MVSLKPSKQRRLLHTLPLHQRKKLLIAKVSDEIASQY-GiKRIRVRKGDTVRVMRGNHNGKEGKVTEINTRTGRLAIEGI 79
gi 229579217   1 MVSLKPSKQRRLLHTLPLHQRKKLLIAKVSDEIASQY-GiKRIRVRKGDTVRVMRGNHNGKEGKVTEINTRTGRLAIEGI 79
gi 13541167    1 --------------------MYDKLNVALSKDLRKKY-GiRSFPIVKGDVVKVVSGARKGEGGKVAEVDHHSGLVIVEGI 59
gi 16082661    1 --------------------MYRKMEVSLSKDLRKKY-GiRSFPVIMGDVVKVISGSRKGEGGKVAEVDHASGLVVVEGI 59
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 219851118  84 SVTKADGTEVPRKVDPSNVQIIKLNLKDPRRAAKLGEVA 122
gi 229582031  80 TRKKADGTPVYVWIHASKVMITKLDLSDPRRREKLEKSK 118
gi 284997905  80 TRKKADGTPVYVWIHASKVMITKLDLSDPRRREKLEKSK 118
gi 238619873  80 TRKKADGTPVYVWIHASKVMITKLDLSDPRRREKLEKSK 118
gi 227827702  80 TRKKADGTPVYVWIHASKVMITKLDLSDPRRREKLEKSK 118
gi 229584906  80 TRKKADGTPVYVWIHASKVMITKLDLSDPRRREKLEKSK 118
gi 227830398  80 TRKKTDGTPVYVWIHASKVMITKLDLSDPRRREKLEKSK 118
gi 229579217  80 TRKKADGTPVYVWIHASKVMITKLDLSDPRRREKLEKSK 118
gi 13541167   60 TIAKIDGKQKGFGISPEKLQITHLDLSRSERFQKIKELA 98
gi 16082661   60 TIARADGKQKGFGIQPEKLQITHLDLSRGDRFDKIKSLA 98
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap