Conserved Protein Domain Family
PLN02602

?
PLN02602: PLN02602 
lactate dehydrogenase
Statistics
?
PSSM-Id: 178212
View PSSM: PLN02602
Aligned: 17 rows
Threshold Bit Score: 509.312
Threshold Setting Gi: 302772721
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PLN02602 is classified as a model that may span more than one domain.
PLN02602 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115465906   1 MKKASSLSE-----LGFDADGPSFFRHLTLTDgd-------dGTLPRRRLIKISVIGAGNVGMAIAQTILTQDLADEIVL 68
gi 168052680   1 ---------------MAEKVGKQLFQTIPGSG----------PPPAVKRTYKVTVVGVGNVGMACAQTILTQDLCDELAL 55
gi 168051701  16 WREEEAKHEpgsafELTDKVANQLFKSIPGSS----------ISNVPRRTSKVTVVGVGNVGMACAQTILTQDLCDELAL 85
gi 168006237   1 ---------------MAEKVVNKLFRPIPGSS----------VSEEGKRTHKVTVVGVGNVGMACAQTILTQELCDELAL 55
gi 242060128   1 MKKASSLSEl---gFDAGDASSGFFRPVSDSSssaadgvvvtPSAHRRRLTKVSVIGAGNVGMAIAQTILTRDLADEIAL 77
gi 242060130   1 MKKATSLSEl---gFDANGASAGFFRSVSDDAmdd----stpTSHHRRRLTKVSVIGAGNVGMAIAQTILTRDLADEIAL 73
gi 225453959   1 MEKSSSASSl---gPLGLDIAQSFFKPIQQAA----------PPSPTKRHTKISVIGVGNVGMAIAQTILTQGLIDELAL 67
gi 225427017   1 MHKSGSASSl---gPGGLDLTQAFFKPIQQTA----------PPSPTKRHTKVSVIGVGNVGMAIAQTILTQDLVDELAL 67
gi 302814286   1 --------------------------------------------------------------MACAQTILTQELAEELAL 18
gi 302823291   1 ---------------------------------------mavADIVQRDVTKVTVVGVGNVGMACATSILSKRLCRSLVL 41
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115465906  69 IDAVADKVRGEMLDLQHAAAFLPRVNIVSGTEVSLTRSSDLVIVTAGARQIP-GETRLNLLQRNVSLFRKIVPAAAEASP 147
gi 168052680  56 VDVVEEKLKGEMLDLQHAAAFLPGSKIMADTDYKVTEGSDLCIVTAGARQRE-GESRLALVEKNVTLFKNIIPQLVKYSP 134
gi 168051701  86 VDVVEEKLKGEMLDLQHAAAFLPRSKILADTDYKVTADSDICIVTAGARQRE-GESRLALVEKNVSLFKKIIPQLVKHSP 164
gi 168006237  56 VDVVEEKLKGEMLDLQHAAAFLPRAKILADTDYRVTADSDICIVTAGARQQE-GQSRLALVEKNVSLFKKIIPELMKHSP 134
gi 242060128  78 VDALPDKLRGEMLDLQHAAAFLPRTRLVSDTDMSVTRGSDLAIVTAGARQIP-GETRLNLLQRNVALFRKIVPALAEQSP 156
gi 242060130  74 VDALPDKLRGEMLDLQHAAAFLPRTRLVSDTDMSVTRGSDLAIVTAGARQIP-GETRLNLLHRNVALFRKIVPALAEHSP 152
gi 225453959  68 VDVNPDKLRGEMLDLQHAAAFLPRTKILASVDYSVTAGSDLCIVTAGVRQGS-GESRLNLVQRNVKLFSCIIPQLAHSSP 146
gi 225427017  68 VDVNADKLRGEMLDLQHAAAFLPRTKIHASVDYAITAGSDLCIVTAGARQIA-GESRLNLLQRNVSLFSRIVPPLAKYSP 146
gi 302814286  19 IDVNPDKLRGEMLDLQHAAAFLQRATISASTDYAASAGSDVCIITAGARQRE-GETRLDLTARNAALYCNIVPELVRHSP 97
gi 302823291  42 IDVMGDKLKGEMMDLQHAAAFNPNVDICASTDYANTRNSQICIITAGAKQKShDESRLALVQSNVELLRKIIPELLKYSP 121
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115465906 148 ESVLVIVSNPVDVLTYVAWKLSG--FPASRVIGSGTNLDSSRFRFLLAEHLEVSAQDVQAYMVGEHGDSSVALWSSISVG 225
gi 168052680 135 DTTLLIISNPVDALTYVAYKLSG--LPPNRVIGSGTNLDSSRFRWLLADHLHVNAQNVHGYIVGEHGDSSVPLWSSVSVG 212
gi 168051701 165 DTILLIISNPVDALTYVAYKLSG--LPPNRVIGSGTNLDSSRFRWLLADHLDVNAQNVHGYIVGEHGDSSVPLWSSVSVG 242
gi 168006237 135 NTILLVISNPVDALTYVAYKLSG--LPPNRVIGAGTNLDSSRFRWLLADHLDVNAQNVHGYIVGEHGDSSVPLWSSVSVG 212
gi 242060128 157 DALLLVVSNPVDVLTYVAWKLSG--FPASRVIGSGTNLDSSRFRFLLAEHLDVNAQDVQAYMVGEHGDSSVAVWSSVSVA 234
gi 242060130 153 DAILLIVSNPVDVLTYVAWKLSG--FPVSRVIGSGTNLDSSRFRFLLAEHLDVNAQDVNAYMVGEHGDSSVAVWSTVSVA 230
gi 225453959 147 DSILLIVTNPVDVLTYVAWKLSG--FPSNRVIGSGTNLDSSRFRFLIADHLDVSAQDVQAFIVGEHGDSSVALWSSISVG 224
gi 225427017 147 DSILLIVSNPVDILTYVAWKLSG--FPSNRVLGSGTNLDSSRFRFLIADHLDVNAQDVQAYIVGEHGDSSVALWSSISVG 224
gi 302814286  98 GAVLLVVSNPVDVLAWATWQLAGsvLPATRVIGSGTNLDTARLRFLLAEQMGANARDVQAYVLGEHGDSSVPVWSTVSVA 177
gi 302823291 122 DTLLLVVSNPVDILTYVSWKISG--LPASRVLGSGTNLDSSRFRFLISSRMDVSSKNVHGYIIGEHGDSSVPVWSSVNVA 199
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115465906 226 GMPVLAHLQKNHRSaatakkFDEAALEGIRRAVVGSAYEVIKLKGYTSWAIGYSVASIAWSLLRDQRRIHPVSVLAKGLv 305
gi 168052680 213 GVPFLAFLKHKQIE------YTIDTLTELHKMVVDGAYEVIKLKGYTSWAIGYSVASLVKSLLRDQRRIHPVSVCAQGF- 285
gi 168051701 243 GIPIISYLKQRHID------YNPDTLSELHRIVVDGAYEVIKLKGYTSWAIGYSVASLVKSVLRDQRRIHPVSVCSQGF- 315
gi 168006237 213 GVPIISYLKQKHID------YSPDTLAELHRMVVDGAYEVIKLKGYTSWAIGYSVASLVKSVLRNQRRIHPVSVCSQGF- 285
gi 242060128 235 GMPVLKSLQQSHSS------FDEEALEGIRRAVVDSAYEVISLKGYTSWAIGYSVASLAASLLRDQRRIHPVSVLARGF- 307
gi 242060130 231 GMPVLKSLQESHSS------FGEEALEGIRRAVVDSAYEVIGLKGYTSWAIGYSVANLVSSLLRDQRRIHPVSVLASGF- 303
gi 225453959 225 GVPILGFLENQQIT------FSKETLENIHKEVINSAYEVISLKACTSWAIGYSGASLARTILXXXXXXXXVSILAKGF- 297
gi 225427017 225 GVPVLSFLEKQQIA------YEKETLENIHKAVIDSAYEVISLKGYTSWAIGYSAASLARSILRNQRRIHPVSVLAKGF- 297
gi 302814286 178 G----RILREEWGP------SSSAELEELHRGVVESAYEVIRLKGYTSWAIGYSTASIVRNILRDQRRICPVSVMAKGF- 246
gi 302823291 200 GVPLLNFIEKEGLE---------SEVEKINQEVVKSAYEIIKFKGYTNWAIGASVADIVHSLIRDEKAIHPVSIIAKGR- 269
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 115465906 306 RGVpADRELFLSLPARLGRAGVLGVaAELVLTDEEERRLRISAETLWGYCHALGL 360
gi 168052680 286 HGI--EDEVYLSLPAEIGRTGIIGV-LDNPLTDDERAQLQKSAKTLTEVQKQLDI 337
gi 168051701 316 HGI--KDQAYLSLPAEIGRSGIIGV-MDSPLTDEEREQLQKSAKTMAEIQKKLDI 367
gi 168006237 286 HGI--EDEVCLSLPAVIGRAGIVSV-LDSPLTDEEKEQLQTSAKTLALIQNKLDM 337
gi 242060128 308 HGIpDENDVFLSLPARLGRAGVQGV-AEMELTEEEAKRLRRSAKTLWENCQLLGL 361
gi 242060130 304 HGIpDDHEVFLSLPARLGRAGVLGV-ADMDLTDEETRRLRRSAKTLWENTQLLGL 357
gi 225453959 298 YGI-DGDEVFLSLPVQLGRSGVLGV-ANVHLTDEEAQRLRDSAEIIAQVQSQLNG 350
gi 225427017 298 YGI-EGGDVFLSLPAQLGRGGILGV-TNVHLTDEEAQRLRDSAKTILEVQNQLGL 350
gi 302814286 247 YGI--EEEVFLSLPVQLGRNGVVSV-VNAPLSEEEAAKLRGSAKTLWNVQQQLKL 298
gi 302823291 270 HGI--EHDVFLSLPCVLGRNGVLHI-VEQTLTENEVLKLKESAQSLWDVVKNAEL 321
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap