Conserved Protein Domain Family
COX1

?
MTH00182: COX1 
cytochrome c oxidase subunit I; Provisional
Statistics
?
PSSM-Id: 214451
View PSSM: MTH00182
Aligned: 33 rows
Threshold Bit Score: 810.974
Threshold Setting Gi: 200004088
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
MTH00182 is a member of the superfamily cl00275.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109156416   1 MNLYLTRWVFSTNHKDIGTLYLVFGVGAGMIGTAFSVLIRLELSAPGAMLGDDHLYNVIVTAHAFIMIFFLVMPVMIGGF 80
gi 107736210   1 MNKYLTRWLFSTNHKDIGTLYLLFGAFSGMAGTASSMLIRLELSAPGSMLGDDHLYNVIVTAHALLMIFFLVMPVMIGGF 80
gi 109156457   1 MNKYLTRWLFSTNHKDIGTLYLLFGAFSGMAGTASSMLIRLELSAPGSMLGDDHLYNVIVTAHALLMIFFLVMPVMIGGF 80
gi 109156566   2 NNKFLTRWVFSTNHKDIGTLYLIFGIGSGMIGTALSMLIRLELSAPGTMLGDDHLYNVIVTAHAFLMIFFLVMPVMMGGF 81
gi 115494861   2 VDRYLARWLFSTNHKDIGTLYLIFGIRSGMVGTALSMLIRLELSAPGTMLGDDHLYNVIVTAHALIMVFFLIMPVMIGGF 81
gi 20065796    2 KSLYVVRWGFSTNHKDIGTLYLVFGIGAGMIGTAFSMLIRLELSAPGAMLGDDHLYNVIVTAHAFIMIFFLVMPVMIGGF 81
gi 6137783     2 DNKFLTRWVFSTNHKDIGTLYLVFGIGSGMIGTALSMLIRLELSAPGTMLGDDHLYNVIVTAHAFIMIFFLVMPVMIGGF 81
gi 189095613   1 MNKYLTRWLFSTNHKDIGTLYLLFGAFSGMAGTASSMLIRLELSAPGSMLGDDHLYNVVVTSHALLMIFFLVMPVMIGGF 80
gi 192293779   1 MNKYLTRWLFSTNHKDIGTLYLLFGAFSGMAGTASSMLIRLELSAPGSMLGDDHLYNVVVTSHALLMIFFLVMPVMIGGF 80
gi 164420822   1 MYNWITRWMFSTNHKDIGTLYIVFGAFSGMIGTALSMLIRIELSAPGRIIGDDHLYNVIVTAHAFVMIFFLVMPVLIGGY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109156416  81 GNWLVPLYIGAPDMAFPRLNNISFWLLPPALILLLGSAFVEQGVGTGWTVYPPLSNIQAHSGGAVDMAIFSLHLAGASSI 160
gi 107736210  81 GNWFVPIMIGAPDMAFPRLNNISFWLLPPSLILLAGSMFVEQGAGTGWTIYPPLAGIQAHSGGAVDMAIFSLHLAGVSSI 160
gi 109156457  81 GNWFVPIMIGAPDMAFPRLNNISFWLLPPSLILLAGSMFVEQGAGTGWTIYPPLASIQAHSGGAVDMAIFSLHLAGVSSI 160
gi 109156566  82 GNWFVPLYIGAPDMAFPRLNNISFWLLPPALILLLGSAFVEQGVGTGWTMYPPLASIQTHSGGAVDMAIFSLHLAGASSI 161
gi 115494861  82 GNWLVPLYIGAPDMAFPRLNNISFWLLPPALILLLGSSFVEQGVGAGWTIYPPLSSIQAHSGGAVDMAIFSLHLAGASSI 161
gi 20065796   82 GNWLVPLYIGAPDMAFPRLNNISFWLLPPALILLLGSAFVEQGVGTGWTVYPPLSSIQAHSGGAVDMAIFSLHLAGVSSI 161
gi 6137783    82 GNWLVPLYIGAPDMAFPRLNNISFWLLPPALILLLGSAFVEQGVGTGWTVYPPLSAIQAHSGGAVDMAIFSLHLAGASSI 161
gi 189095613  81 GNWFVPIMIGAPDMAFPRLNNVSFWLLPPSLILLVGSMFVEQGAGTGWTIYPPLASIQAHSGGAVDMAIFSLHLAGVSSI 160
gi 192293779  81 GNWFVPIMIGAPDMAFPRLNNISFWLLPPSLILLVGSMFVEQGAGTGWTIYPPLASIQAHSGGAVDMAIFSLHLAGVSSI 160
gi 164420822  81 GNWFVPIYIGAPDMAFPRLNNLSFWLLPPALILLLTSSLVEQGAGTGWTVYPPLSGPLAHSGGSVDLAIFSLHCAGFSSI 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109156416 161 LGAMNFITTILNMRAPGITLDRMPLFVWSILITAFLLLLSLPVLAGGITMLLTDRNFNTTFFDPAGGGDPILFQHLFWFF 240
gi 107736210 161 LSSINFITTIINMRVPGMSMHRLPLFVWSVLITTILLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILFQHLFWFF 240
gi 109156457 161 LSSINFITTIINMRVPGMSMHRLPLFVWSILITTILLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILFQHLFWFF 240
gi 109156566 162 LGSMNFITTVFNMRAPGVTMDRLPLFVWSVLITAFLLLLSLPVLAGGITMLLTDRNFNTTFFDPAGGGDPILFQHLFWFF 241
gi 115494861 162 LGAMNFITTIFNMRAPGVTMDRLPLFVWSILITAFLLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILFQHLFWFF 241
gi 20065796  162 LGAMNFITTILNMRAPGMTLNKMPLFVWSILITAFLLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILFQHLFWFF 241
gi 6137783   162 LGAMNFITTIFNMRAPGMTMDRLPLFVWSILITAFLLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILFQHLFWFF 241
gi 189095613 161 LSSINFITTIINMRVPGMSMHRLPLFVWSVLVTTILLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILFQHLFWFF 240
gi 192293779 161 LSSINFITTIINMRVPGMSMHRLPLFVWSVLVTTILVLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILFQHLFWFF 240
gi 164420822 161 AGAINFITTVFNMRTPGLTFDKLPLFVWSVLITAFLLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPVLYQHLFWFF 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109156416 241 GHPEVYILILPGFGMISQIIPTFVAKRQIFGYLGMVYAMLSIGILGFIVWAHHMFTVdfsyskGMDVDTRAYFTAATMII 320
gi 107736210 241 GHPEVYILILPGFGIISQIIPTFSAKQHIFGYLGMVYAMISIGVLGFIVWAHHMFTV------GMDVDTRAYFTAATMII 314
gi 109156457 241 GHPEVYILILPGFGMVSQIIPTFSAKQHIFGYLGMVYAMISIAVLGFIVWAHHMFTV------GMDVDTRAYFTAATMII 314
gi 109156566 242 GHPEVYILILPGFGMISQIIPTFSAKNQIFGYLGMVYAMISIGILGFIVWAHHMFTV------GMDVDTRAYFTAATMII 315
gi 115494861 242 GHPEVYILILPGFGMISQIVPTFSAKKQIFGYLGMVYAMLSIGILGFIVWAHHMFTV------GMDVDTRAYFTAATMII 315
gi 20065796  242 GHPEVYILILPGFGMISQIIPTFVAKKQIFGYLGMVYAMLSIGILGFIVWAHHMFTV------GMDVDTRAYFTAATMII 315
gi 6137783   242 GHPEVYILILPGFGMVSQIIPTFSAKNQIFGYLGMVYAMLSIGILGFIVWAHHMFTV------GMDVDTRAYFTAATMII 315
gi 189095613 241 GHPEVYILILPGFGIVSQIIPTFSAKQHIFGYLGMVYAMISIGILGFIVWAHHMFTV------GMDVDTRAYFTAATMII 314
gi 192293779 241 GHPEVYILILPGFGIVSQIIPTFSAKQHIFGYLGMVYAMISIGILGFIVWAHHMFTV------GMDVDTRAYFTAATMII 314
gi 164420822 241 GHPEVYILIIPGFGIVSQIIPIFSSKNQVFGYLGMIYAQLAIAFLGFIVWAHHMFTI------GMDVDTRAYFTAATMII 314
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109156416 321 AVPTGIKVFSWLATVYGGTLRLDTPMLWALGFVFLFTLGGLTGVVLANSSLDVVLHDTYYVVAHFHYVLSMGAVFAIFGG 400
gi 107736210 315 AVPTGIKIFSWLATIYGGSLRLDTPMLWAIGFVFLFTIGGLTGVILANSSLDIMLHDTYYVVAHFHYVLSMGAVFAIFGG 394
gi 109156457 315 AVPTGIKIFSWLATIYGGSLRLETPMLWAIGFVFLFTLGGLTGVILANSSLDIALHDTYYVVAHFHYVLSMGAIFAIFGG 394
gi 109156566 316 AVPTGIKVFSWLATLYGGAIRLDTPMLWAIGFVFLFTIGGLTGVILANSSLDVVMHDTYYVVAHFHYVLSMGAVFAIFAG 395
gi 115494861 316 AVPTGIKVFSWLATIYGGTLRFDTPMLWAIGFIFLFTIGGLTGVVVANSSLDVVLHDTYYVVAHFHYVLSMGAVFAIFGG 395
gi 20065796  316 AVPTGIKVFSWLATIFGGTLRLDTPMLWAMGFVFLFTLGGLTGVVLANSSLDVVLHDTYYVVAHFHYVLSMGAVFAIFGG 395
gi 6137783   316 AVPTGIKVFSWLATIYGGAVRLDTPMLWAIGFVFLFTIGGLTGVILANSSLDIVLHDTYYVVAHFHYVLSMGAIFAIFAG 395
gi 189095613 315 AVPTGIKIFSWLATIYGGSPRLDTPMLWAIGFVFLFTIGGLTGVILANSSLDIMLHDTYYVVAHFHYVLSMGAIFAIFGG 394
gi 192293779 315 AVPTGIKIFSWLATIYGGSPRLDTPMLWAIGFVFLFTIGGLTGVILANSSLDIMLHDTYYVVAHFHYVLSMGAIFAIFGG 394
gi 164420822 315 AVPTGIKIFSWLATMYGGKINLSTPMLWSAGFVFLFTLGGLTGVILANGSLDILLHDTYYVVAHFHYVLSLGAVFAMFGG 394
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109156416 401 FYYWVGKITGYCYNEFYGKVHFWLMFVGVNLTFFPQHFLGLTGFPRRYSDFADSFAGWNLVSSLGSAVVLVGVVWFMYII 480
gi 107736210 395 YYYWFGKITGFSYNELYGKIHFWIMFIGVNLTFFPQHFLGLAGLPRRYSDFADAYQDWNLVSSCGAVIALIGIMWFIYLS 474
gi 109156457 395 YYYWFGKITGYSYNELYGKIHFWIMFIGVNLTFFPQHFLGLAGLPRRYSDFPDAYQDWNLVSSCGAVIALVGIIWFVYLT 474
gi 109156566 396 FYFWFGKITGYCYNELYGKIHFWIMFIGVNITFFPQHFLGLAGFPRRYSDFADGYAGWNLVCSFGSTISVVGVVWFIFVV 475
gi 115494861 396 FYYWFGKITGYCYNELYGKIHFWLMFIGVNLTFFPQHFLGLAGFPRRYSDFADSFAGWNLVSSLGSTISIVGVLWFIYII 475
gi 20065796  396 FYYWVGKITGYCYNELYGKAHFWLMFIGVNLTFFPQHFLGLTGFPRRYSDFADCFAGWNLVSSLGSTISIVGVVFFIYII 475
gi 6137783   396 FYFWFGKITGYCYNELYGKIHFWIMFIGVNLTFFPQHFLGLAGFPRRYSDFVDGFAGWNLVSSLGSTISIVGVIWFVFIV 475
gi 189095613 395 YYYWFGKITGFSYNELYGKIHFWIMFIGVNLTFFPQHFLGLAGLPRRYSDFADAYQDWNLVSSCGAIIALIGIIWFIYLT 474
gi 192293779 395 YYYWFGKITGFSYNELYGKIHFWIMFIGVNLTFFPQHFLGLAGLPRRYSDFADAYQDWNLVSSCGAIIALIGIIWFIYLT 474
gi 164420822 395 FYFWFGKISGFSINETLGKIHFWITFIGVNLTFFPQHFLGLAGMPRRYADFPDNFYTWNAISSLGSIISIIGVIWFIYVI 474
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|....*....
gi 109156416 481 YDLYVREERFVSWVDISelgwpSLEWVQDSPPLSHTYIEGIFFYIKSSR 529
gi 107736210 475 YEALAAERPFEGWSASPs----SLEWSLCSPPAFHTYNELPFVYQSKLS 519
gi 109156457 475 YEALAAERPFEGWSTSRg----SLEWSLSSPPAFHTYNELPFVYQRKLS 519
gi 109156566 476 YDAYVREVKFIGWVENTgsswpSLEWVQQSPPALHTYNELPFVYGSYST 524
gi 115494861 476 YDAYVREVRFISWIESTesscpSLEWVQPSPPLSHTYNELPFVYGSYAG 524
gi 20065796  476 YDIYVWEEEFIDWMEDQgeswaSLEWAHVSPPLFHTYEELPFVWETIKG 524
gi 6137783   476 YDAYVREIKFIGWVENTgaswsSLEWVQPSPPMSHTYNELPFVYGSYSA 524
gi 189095613 475 YEALAAERPFKSWSTASs----SLEWSLGSPPAFHTYNELPFVYQSKLS 519
gi 192293779 475 YEALAAERPFKSWSTAAs----SLEWSLGSPPAFHTYNELPFVYQSKFS 519
gi 164420822 475 FDAFYSEEKFISWNNLNlektnTLEWSLSCPPSHHTFNELPFINHSNNK 523
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap