NCBI CDD Logo
?
COG5048: COG5048 
FOG: Zn-finger [General function prediction only]
Statistics
?
PSSM-Id: 227381
View PSSM: COG5048
Aligned: 49 rows
Threshold Bit Score: 36.5974
Threshold Setting Gi: 1723676
Created: 7-Oct-2002
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
COG5048 is classified as a model that may span more than one domain.
COG5048 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1177049   450 ATPGVYLLSSGPSLTDLLTMNSAHAGAGGYMSSHHSPFDLGCFSHDKPTVSEFNLPSSFPNTIPSNSTTASNSYSNLANQ 529
gi 19173600    1 ---------------------------------------------------------------------------MLKNR 5
gi 1723598     1 MSLYPLQRFESNDTVFSYTLNSKTELFNESRNNDKQHFTLQLIPNANANAKEIDNNNVEIINDLTGNTIVDNCVTTATSS 80
gi 1352985   291 DTPCTASTSATSGHKFVQDHQSSNNDDVFHKYCKFCEESTDNQPCSKHMHLESKPPQLPPKCSSLRKPTNTLQGTNHAYH 370
gi 462626     57 PEYTFGQFSMDSPHRTDATNTPILTATTNTTANNSLMNLKDTASLATNWKWKNSNNAQFVNDGEKQSSNANGKKNGGDKI 136
gi 462625    127 TTLTSPYPMNDILYNMNNPLQSPSPSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRLSLPNGA 206
gi 1708268    61 TTVSSNKDDVMVNSGARELPMPLHQQQYIYPYYQYTSNNSNNNNVTAGNNMSASPIVHNNSNNSNNSNISASDYTVANNS 140
gi 1710120       --------------------------------------------------------------------------------
gi 6325270     1 ------------------------------------------------MNFSLSKQSSEKQSSYTDKSRSPNIGMCTVNY 32
gi 6325272       --------------------------------------------------------------------------------
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1177049   530 TYRQMSNEQPLMSLSPKNPPTTVSDSSSTINFNPGTNNLLEPSMEPNDKDSNIDPAAIDDKWLSEFINNSDPKSTFKINf 609
gi 19173600    6 VEVDRRRLDFSEESSAGEYNGKYLGFHEQAGETGTYRKVIYSQEGKLVPPQYHTWDRNPHHKDTSPSDKKYHSEYR---- 81
gi 1723598    81 NQLERRLSISDYRTENGNYYEYEFFGRRELNEPLFNNDIVENDDDIDLNNESDVLMVSDDELEVNERFSFLKQQPLDGL- 159
gi 1352985   371 EHILNTDMDLKILEDLCNISSLYEVPFGKHINHHDHNNAGNGCDGSSTGNNENGNQTMNLLLSSINRCNPKNNLNGSNN- 449
gi 462626    137 YSSVATPQALNDELKNLEQLEKVFSPMNPINDSHFNENIELSPHQHATSPKTNLLEAEPSIYSNLFLDARLPNNANSTTg 216
gi 462625    207 NSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLNSSYFNSLNIDSMLDDYVSSDLLLNDDDDDTNLSRRr 286
gi 1708268   141 TSNNNNNNNNNNNNNNNIHPNQFTAAANMNSNAAAAAYYSFPTANMPIPQQDQQYMFNPASYISHYYSAVNSNNNGNNA- 219
gi 1710120     1 -----------------------------------------------MRGKQPKRNKDNASVKRNYRCVGYPDCN----- 28
gi 6325270    33 KSNLPLQVSAVDQLSTGKGTQFYGHNSYKNERECYNSTKINLPPISSLLPNFENNTPPNVDSRVQFPPQQVYQSMN---- 108
gi 6325272     1 ----------------------------MWRTKTLESMLCSPMKCSSSNIGGSYAQSSKEVSNTTKREVHLPPCSS---- 48
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1177049   610 nhfndigfiysppssRSSIPNKSPPNHSATSLNHEKASLSpRLNLSLNGSTDLPSTPQNQLKEPSYSDPISHSSHKRRRD 689
gi 19173600   82 -----------------EGESDSRLDTP----------------ISIEAKWSHYSSEYFEASDSEEFDEKLASLRLLILE 128
gi 1723598   160 ---------------NRISSTNNLKNLEIHEFIIDPTENI-DDELEDSFTTVPQSKKKVRDYFKLNIFGSSSSSNNNSNS 223
gi 1352985   450 ---------------NTAGATSTDHQHHHHRIQFHSHKPNrNNIVNNSGISAANTTADLTNNDLNDLISREYSYERFRNQ 514
gi 462626    217 lndnd----ynlddtNNDNTNSMQSILEDFVSSEEALKFMpDAGRDARRYSEVVTSSFPSMTDSRNSISHSIEFWNLNHK 292
gi 462625    287 fsdvi----tnqfpsMTNSRNSISHSLDLWNHPKINPSNRnTNLNITTNSTSSSNASPNTTTMNANADSNIAGNPKNNDA 362
gi 1708268   220 ---------------ANNGSNNSSHSAPAPAPGPPHHHHH-HSNTHNNLNNGGAVNTNNAPQHHPTIITDQFQFQLQQNP 283
gi 1710120    29 -----------------MSFNRTEHLAR-----------------HIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHS 74
gi 6325270   109 ---------------VVPIVNEIYTPISMN-------------ATSDQYPIYYTESQQPIPHSQSPHLTSSAPLMMPVMV 160
gi 6325272    49 ----------------IMHAPLT-PEIN-----------------QAALPPPAYHYAPSSLHQTEDPVWRSSPNSIIFSP 94
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1177049   690 SVMMDYDLSNFFSSRQLDISKVLNGTEQNNSHVNDDVLTLSFPGETDSNATQKQLPVLTPSDLLspfsvpsvsqvlftne 769
gi 19173600  129 AEEEMRRIVQGRVDKHLEMNKEANEKKKEMKRRKREVLGEVNKVRGEAGDRDDRSCERPEE------------------- 189
gi 1723598   224 LGCEPIQTENSSSQKMFKNRFFRSRKSTLIKSLPLEQENEVLINSGFDVSSNEESDESDHAII----------------- 286
gi 1352985   515 SEPPSLPKVTHQNQKNRRSWPTKDLESTDFSSLEDSLPSSISPPIQTTSTINFNWCFKEEKNND---------------- 578
gi 462626    293 NSSNSKPTQQIIPEGTATTERRGSTISPTTTINNSNPNFKLLDHDVSQALSGYSMDFSKDSGIT---------------- 356
gi 462625    363 TIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSFDANAMTKINPSQQLQQQLNRVQHKQLT---------------- 426
gi 1708268   284 SPNLNLN-INPAQPLHLPPGWKINTMPQPRPTTAPNHPPAPVPSSNPVASNLVPAPSSDHK------------------- 343
gi 1710120    75 --DVD---------LMSLRRLQQSANSTANDPNATRMFPQLRPYGIVVQPAPVPYNLPIST------------------- 124
gi 6325270   161 PTVYKPLTPYDKEPITIASEPNFTAISMASHPNAALELCHDRPKSVPPGYGVLPTMQEASNGR----------------- 223
gi 6325272    95 VIATPQPFPLTFVERQSCCPIYSTAASSYTAQSVPPSMQHFQEENHRAVSNEQYSLPNVHIG------------------ 156
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1177049   770 LRSMMLADNNIDSGAFPTTSQLNDyvtyYKEEFHPffsfiHLPSIIPNMdsyPLLLSISMVGALYGFHSTHAKVLANAAS 849
gi 19173600  190 ESDAKGTRIESFADFETSMFPYK------SKNGA-------KSYACPYEg---CTMELPTLSRIKRHYIVHTKLRPFKCL 253
gi 1723598   287 NPLKLVGNNKDISTQSIAKTTNP------FKSGSD------FKMIEPVS---KFSNDSRKDLLAAISEPSSSPSPSAPSP 351
gi 1352985   579 LKCKWKECPESCSSLFDLQRHLLK-----DHVSQDfk-hpMEPLACNWE---DCDFLGDDTCSIVNHINCQHGINFDIQF 649
gi 462626    357 KPKSISSSLNRISHSSSTTRQQRAsl-pLIHDIESfa--nDSVMANPLS---DSASFLSEENEDDAFGALNYNSLDATTM 430
gi 462625    427 SSHNNSSTNMKSFNSDLYSRRQRAsl-pIIDDSLSyd-lvNKQDEDPKNdmlPNSNLSSSQQFIKPSMILSDNASVIAKV 504
gi 1708268   344 YIHQCQFCEKSFKRKSWLKRHLL------SHSQQ-------RHFLCP-----WCLSRQKRKD----NLLQHMKLKHTNYL 401
gi 1710120   125 --PASPQDTISLYAPPYFPHPMP------SAPIP-------LPHQPP---------PLPIYSYMQPLFLNHTPIQNHNIV 180
gi 6325270   224 TKSEPGAVLNGSATFSDWKTDTR------ISSTK-------LRKQCP-----VCGKICSRPSTLKTHYLIHTGDTPFKCT 285
gi 6325272   157 -QNPGTLLSQTQTDLDLIQKQLR-------AVVK-------LRKQCP-----ICGKVCSRPSTLRTHYLIHTGDTPFKCT 216
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1177049   850 TQIRKSLKVSEKNPEttelwviqtlvlltfycifnkntavikgmHGQLTTIIRLLKASRLNLPLESLCQPPIESDHIMEY 929
gi 19173600  254 NKDCNKRFSRKDN----------------------------------MLQHYKIHCNYSNYR------------------ 281
gi 1723598   352 SVQSSSSSHGLVVRK-----------------------------KTGSMQKTRGRKPSLIPDASKQFGCEFCDRRFKRQE 402
gi 1352985   650 ANPDSFLPGSISKEK-----------------------------HHLLHCPNPQTHEVSKADGAPDMTSANDVSNIPPIK 700
gi 462626    431 SAFDNNVDPFNILKS-----------------------------SPAQDQQFIKPSMMLSDNASAAAKLATSGVDNITPT 481
gi 462625    505 ATTGLSNDMPFLTEE-----------------------------GEQNANSTPNFDLSITQMNMAPLSPASSSSTSLATN 555
gi 1708268   402 LDELKKNNIIFNYNN-----------------------------SSSSNNNNDNNNNNNSNSASGSGGAGAAAAAATAPE 452
gi 1710120   181 ELPPDSSDTPASPSK------------------------------VQSFDQAKDASPNAKK------------------- 211
gi 6325270   286 WEGCTKSFNVKSNML-----------------------------RHLKSHERKRNKVLNTT------------------- 317
gi 6325272   217 WEHCNKSFNVKSNML-----------------------------RHLRTHQKKIAKKKHQ-------------------- 247
                        490       500       510       520       530       540
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1177049   930 ENSPHMFSKIREQYNAPNQMNKNYQYFVLAQSRIRTCHAVLLISNLFSSLVGADCCFHSVD 990
gi 19173600      -------------------------------------------------------------
gi 1723598   403 HLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKTHASL-------------------- 443
gi 1352985   701 QPEQVICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKV 761
gi 462626    482 PAFQRRSYDISMNSSFKILPTSQAHHAAQHHQQQPTKQATVSPNTRRRKSSSVTLSPTISH 542
gi 462625    556 HFYHHFPQQGHHTMNSKIGSSLRRRKSAVPLMGTVPLTNQQNNISSSSVNSTGNGAGVTKE 616
gi 1708268   453 NEDGNGYDT--NIKTLINDGVLNKDDVKRVLNNLIVSHNK--------------------- 490
gi 1710120       -------------------------------------------------------------
gi 6325270       -------------------------------------------------------------
gi 6325272       -------------------------------------------------------------
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap