Conserved Protein Domain Family
AAA

?
cd00009: AAA 
Click on image for an interactive view with Cn3D
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Links
?
BioAssay Targets and Results
?
CID: 25110544
AID: 1794
GI: 111305821
more
Summary of probe development efforts to identify inhibitors of the p97 ATPase.
Chemical Name: MLS002391576
CID: 50918586
AID: 504650
GI: 111305821
IC50: 0.045µM
more
p97 ATPase dose response - Hit Optimization Round 3
Chemical Name: KUC108867N
IC50: 0.045µM
CID: 50918592
AID: 504650
GI: 111305821
IC50: 0.043µM
more
p97 ATPase dose response - Hit Optimization Round 3
Chemical Name: KUC108868N
IC50: 0.043µM
Statistics
?
PSSM-Id: 99707
View PSSM: cd00009
Aligned: 133 rows
Threshold Bit Score: 36.3551
Threshold Setting Gi: 2499046
Created: 1-Nov-2000
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
Hierarchy
?
 
Conserved site includes 10 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:
  • Structure:2C9C_A; Escherichia coli transcription activator PspF binds ATP and Mg2+, contacts calculated at 3.5 A
    View structure with Cn3D

cd00009 is part of a hierarchy of related CD models.
Use the graphical representation to navigate this hierarchy.
cd00009 is a member of the superfamily cl21455.
cd00009:AAA1161447404463391575613053813054254419724942032675381175978116880817094871709488135966613662213517722494203249420528281932HCB A2Z4R A11870711870811693642494138461940116936625063584619411352276117673224962442496255249625814002525060912497390249739124973942497396249739224973972497395249612324987131DO2 A7297771UM8 A4617555863441QVR A13462461705922116897424937354165881IN4 A1IXR C617496924988731708857173082224964911LV7 A2CE7 A2DHR A2QZ4 A24925123CF1 A17298961XWI A2RKO A3B9P A3CF0 A24925044643473219842548458312263217298622492526134267462627117344533343011JBK A1QVR A2P65 A134624617059231KSF X1165191168972116954411689741IQP A2CHQ A1SXJ C1SXJ D17030511SXJ B17030545865181188071SXJ A1703056170579217099962499046585414585415117679411700437307741NY5 A1285991OJL A25007481136291366002C9C A1169293128604418451118399134601454944711762655855861262231708088585965117337062266601161447404463391575613053813054254419724942032675381175978116880817094871709488135966613662213517722494203249420528281932HCB A2Z4R A11870711870811693642494138461940116936625063584619411352276117673224962442496255249625814002525060912497390249739124973942497396249739224973972497395249612324987131DO2 A7297771UM8 A4617555863441QVR A13462461705922116897424937354165881IN4 A1IXR C617496924988731708857173082224964911LV7 A2CE7 A2DHR A2QZ4 A24925123CF1 A17298961XWI A2RKO A3B9P A3CF0 A24925044643473219842548458312263217298622492526134267462627117344533343011JBK A1QVR A2P65 A134624617059231KSF X1165191168972116954411689741IQP A2CHQ A1SXJ C1SXJ D17030511SXJ B17030545865181188071SXJ A1703056170579217099962499046585414585415117679411700437307741NY5 A1285991OJL A25007481136291366002C9C A116929312860441845111839913460145494471176265585586126223170808858596511733706226660
cd00009 Sequence Cluster
cd00009 Sequence Cluster
Sub-family Hierarchy
Click to see CD Hierarchy help
CD Hierarchy
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                               ########                                
1DO2_A       17 IGQDNAKRSVAIAlrnrwrrmqlneelrhevtpkNILMIGPTGVGKTEIARRLakla--------------napFIKVEA 82
2C9C_A       13 NSFLEVLEQVSHLapl----------------dkPVLIIGERGTGKELIASRLhylss-----------rwqgpFISLNC 65
gi 116144    60 HLVIGRAREKLGLtsga--------------ptlHMAFTGNPGTGKTTVALKMaqilhrl-------gyvrrghLVSVTR 118
gi 130538   459 GVITSCNKRKAIArkrq--------------vpvCYILTGPPGCGKTTAAQALakklsd---------qepsviNLDVDH 515
gi 130542   497 DLHTMVLGKINMTkqrp--------------qpvAVIFKGAPGIGKTYLVHRIardlgc---------qhpstiNFGLDH 553
gi 135966   109 YERVQTGELETFRfeear------------staqSLLLIGCSGSGKTTSLHRIlatypqviy----hrelnveqVVYLKI 172
gi 1351772  105 IGRAIFGTISSVRdlle--------------sqqSILLLGKPGVGKTTIIREIarvlsd----------emekrVVIVDT 160
gi 2494203 2855 FDQMLDHVLRIDRiyrq--------------sqgHLLLIGTAGAGKTTLSRFVawln--------------glsVFQLKV 2906
gi 2494205 2809 FDDVLDHILRIDRvlkq--------------plgHLLLVGSSGVGKTTLTRFVswin--------------nltVFQIKA 2860
gi 2828193   28 AVVGQDRAIRLLTiaif--------------argHVMLEGDVGVGKTTLLRAVarglggayervegtvdmmptdLIYHTY 93
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
1DO2_A       83 tkftevgyvgkevdsiirdltdaavkmvrvqaieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkkl 162
2C9C_A       66 aalnenlldselfgheaga------------------------------------------------------------- 84
gi 116144   119 ddlvgqyightap------------------------------------------------------------------- 131
gi 130538   516 hdtytgnevciidefdss-------------------------------------------------------------- 533
gi 130542   554 fdsytgeevaiadefntcg------------------------------------------------------------- 572
gi 135966   173 dcshngslkeiclnffraldralgsnye---------------------------------------------------- 200
gi 1351772  161 sneiagdsdiphsaigrarrmq---------------------------------------------------------- 182
gi 2494203 2907 hskytaadfdedmrtvlrragcrneklcfimdesnmldt----------------------------------------- 2945
gi 2494205 2861 grdyqladfdndlr------------------------------------------------------------------ 2874
gi 2828193   94 lgedgrprvep--------------------------------------------------------------------- 104
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
1DO2_A      163 regqlddkeieidlaaapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkqda 242
2C9C_A       85 ----------------------------------------------------------------------ftgaqkrhpg 94
gi 116144   132 ----------------------------------------------------------------------------ktke 135
gi 130538   534 ----------------------------------------------------------------------dkvdyanfvi 543
gi 130542   573 ----------------------------------------------------------------------dgeswvelfi 582
gi 135966   201 -------------------------------------------------------------rryglkrhgietmlalmsq 219
gi 1351772  183 -------------------------------------------------------------------vattdlqhqimie 195
gi 2494203 2946 --------------------------------------------------gflerlntllangevpglfegdehttlmtq 2975
gi 2494205 2875 ---------------------------------------------------------------------------evmkr 2879
gi 2828193  105 -----------------------------------------------------------------------------gpv 107
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                   #                                                              #    
1DO2_A      243 idaveqhgIVFIDEidkickrgessgpdvsregvQRDLLPLVEgctvstkh----------gmvktdhiLFIASGAfqia 312
2C9C_A       95 rferadggTLFLDElata------------pmmvQEKLLRVIEygelervgg---------sqplqvnvRLVCATNadlp 153
gi 116144   136 ilkkamggVLFIDEayyl------------yrpeNERDYGQEAieillqvm-----------enqrddlVVILAGYkdrm 192
gi 130538   544 gmvnsapmVLNCDMl------------------eNKGKLFTSKyiimtsnsetpvkpsskragafyrrvTIIDVTNpfve 605
gi 130542   583 qmvntnpcPLNCDKa------------------eNKNKVFNSKyllcttnsnmilnathpragafyrrvMIVEARNkave 644
gi 135966   220 ianahalgLLVIDEiqhl------------srsrSGGSQEMLNffvtmv---------------niigvPVMLIGTpkar 272
gi 1351772  196 avenhmpqVIVIDEigt---------------elEALAARTIAek----------------------gvQLVGTTHgnc- 237
gi 2494203 2976 ikegaqrqGLILDShdel------------ykwfTQQVMRNLHvvftmnpsgsgl---rerastspalfNRCVLNWfgdw 3040
gi 2494205 2880 agakgekiTFIFDEsnvl------------gpsfLEKMNALLAsgeipgl-------------fendeyLALINLLkens 2934
gi 2828193  108 lrraedlsVFFFNEinra------------rpqvHALLLRIMAersvsafn----------reyrfpnlQVFADRNrver 165
                       330       340       350
                ....*....|....*....|....*....|....*....
Feature 1                                              
1DO2_A      313 k----------------psdliPELqGRLp--IRVELQA 333
2C9C_A      154 amv-------------negtfrADLlDRLa-fDVVQLPP 178
gi 116144   193 d-----------------rffeSNPgFRSriaHHIDFPD 214
gi 130538   606 shkr----------arpgtsvpRSCyKKNf--SHLSLAK 632
gi 130542   645 swqa----------trhgskpgKSCySKDm--SHLTFQV 671
gi 135966   273 ei--------------feadlrSARrGAGf--GAIFWDP 295
gi 1351772  238 -------------------lenLIKnPPLs--DLIGGIQ 255
gi 2494203 3041 senalyqvgseltrtmdldrtdYEGsVRLtpsCELVPSQ 3079
gi 2494205 2935 nqnkq--------fdsseeqlfKNFtYQVqrnLHVVFTM 2965
gi 2828193  166 e-----------------etfeLPAaARDrflMEIGMEA 187

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D
Conserved site includes 10 residues -Click on image for an interactive view with Cn3D