NCBI CDD Logo
?
cd01036: ClC_euk 
Chloride channel, ClC. These domains are found in the eukaryotic halogen ion (Cl-, Br- and I-) channel proteins that perform a variety of functions including cell volume regulation, membrane potential stabilization, charge compensation necessary for the acidification of intracellular organelles, signal transduction and transepithelial transport. They are also involved in many pathophysiological processes and are responsible for a number of human diseases. These proteins belong to the ClC superfamily of chloride ion channels, which share the unique double-barreled architecture and voltage-dependent gating mechanism. The gating is conferred by the permeating anion itself, acting as the gating charge. Some proteins possess long C-terminal cytoplasmic regions containing two CBS (cystathionine beta synthase) domains of putative regulatory function.
Statistics
?
PSSM-Id: 79363
View PSSM: cd01036
Aligned: 11 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 6-Mar-2002
Updated: 17-Apr-2007
Structure
?
Aligned Rows:
Hierarchy
?
Display:
 
putative Cl-putative pore
Feature 1:putative Cl- selectivity filter
Evidence:
  • Comment:Based on sequence similarity to other members of the family.

cd01036 is part of a hierarchy of related CD models.
Use the graphical representation to navigate this hierarchy.
cd00400:Voltage_gated_ClCcd01031:EriCcd01033:ClC_likecd01034:EriC_likecd01036:ClC_eukcd03682:ClC_sycA_likecd03683:ClC_1_likecd03684:ClC_3_likecd03685:ClC_6_like12311826717451066812873574026320717486407165520168128937174295915232105752510717526739615240576213210264837443315215300718971534911924317559050199221121705910668186036681916790970734170590154402411641414574026285730739108461545574755531486314189611453035614530585719958196680085366807959674814856748217138500986848809944985397684852515054913185084057572272008377631929374036504245558510737732184155443801705905557708405923861215501168397557750560967202097021744243145305822989308650552612716514021231182671745106681287357402632071748640716552016812893717429591523210575251071752673961524057621321026483744331521530071897153491192431755905019922112170591066818603668191679097073417059015440241164141457402628573073910846154557475553148631418961145303561453058571995819668008536680795967481485674821713850098684880994498539768485251505491318508405757227200837763192937403650424555851073773218415544380170590555770840592386121550116839755775056096720209702174424314530582298930865055261271651402
cd01036 Sequence Cluster
cd01036 Sequence Cluster
Sub-family Hierarchy
Click to see CD Hierarchy help
 cd01036 Branch
 Whole Hierarchy
 [Download CDTree]
CD Hierarchy
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 1705901    98 GLLMALVSWVMDYAIAACLQAQqwmsrgl---------------------------------------ntsillqYLAWV 138
gi 1742959    84 GIGTGLAAVFINLSVENFAGWKfaltfaii--------------------------------------qksyfagFIVYL 125
gi 12311826  152 ALSVGVVATVVSYAVDILEKYRaevlyrimtsq--------------------------------rhrsvgnlqgLLYTV 199
gi 1705905    78 GLASGALAGLIDIAADWMTDLKegiclsalwynheqccwgsnettfeerdkcpqwktwaeliigqaegpgsyimnYIMYI 157
gi 4557475    57 GVLMALVSCAMDLAVESVVRAHqwlyrei---------------------------------------gdshllrYLSWT 97
gi 68128735  171 GGDDEKAAVVLRTLSWSALLHG-----------------------------------------------------GVLYT 197
gi 71745106  141 AVTVGVVAIIVSYSVELIQDHRehllvrlmnk----------------------------------ggfgwctlaLFIDL 186
gi 74026320  159 AQTVGGGAGFPMRSTPSGVSWAvag------------------------------------------------kcYIIYI 190
gi 71748640  128 TAMFEGVGVGLYGISPRSYMKG-----------------------------------------------------YLMWV 154
gi 71655201  151 AALFEGVGVGLYGIEPRSLKKG-----------------------------------------------------YLMWI 177
gi 68128937  108 VWAMLRGYSVGLYGIASPRWYWs---------------------------------------------------gYLLWV 136
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                              #####                                       #####         
gi 1705901   139 TYPVVLITFSAGFTqiLAPQAVGSGIPEMKTILRGVvlkeYLTLKTFIAKVIGLTCALGSGm--pLGKEGPFVHIASMCA 216
gi 1742959   126 LINLVLVFSSAYIItqFAPAAAGSGIPEIKGYLNGIdipgTLLFRTLIGKIFGSIGSVGGGl--aLGKEGPLVHTGACIA 203
gi 12311826  200 VGSVVLVAIAAGVVvyFEPAASGGGIPDVMAYLNGVhlrkAMNLRTFIAKAISCICAVAGGl--pVGLEAPLIHLGAITG 277
gi 1705905   158 FWALSFAFLAVSLVkvFAPYACGSGIPEIKTILSGFiirgYLGKWTLMIKTITLVLAVASGl--sLGKEGPLVHVACCCG 235
gi 4557475    98 VYPVALVSFSSGFSqsITPSSGGSGIPEVKTMLAGVvledYLDIKNFGAKVVGLSCTLACGstlfLGKVGPFVHLSVMMA 177
gi 68128735  198 MWGVLMALLSSLCCl-VMPSAAGSGIPDVMAYLNGVmfprIFNIRNLVVKTLSCILAVSAGl--pVGTEGPMIHMGSLIG 274
gi 71745106  187 CTSIWFVMIAAGVVvyFEPGAAGGGIPDVMAYLNGVhvpkVMTLRTFVVKSISCVCGVAGGl--pVGLEAPLIHLGAIVG 264
gi 74026320  191 LWCAGFALLSSLCCl-VMPTAAGSGVPEVMAYLNGVmfprVFNIRNLIVKTLSCIFVVSAGv--pVGAEGPIIHIGSLIG 267
gi 71748640  155 SFSFVTSLISSVICi-CVPGSVGAGMPEVMAYLNGVdypmLGSFGVLLAKIASVVFSVASGv--cTGHCGTLMLTGAMVG 231
gi 71655201  178 SFSLVLSVISSLICl-LVPESIGSGLPEVMAYLNGVhypmLGSFRVLLAKVSFIIFSVASGa--cTGHFGTIILTGAMLG 254
gi 68128937  137 AFAVCTSAIASGMCy-LVPQSVGSGIPEVRAFLNGVsypmMRSTRVLVAKTVAVVFTVASGv--cTDHYSHLMLAGAMLG 213
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 1705901   217 ALLSKFLSLfgg--------iyeNESRNTEMLAAACAVGVGCCFAAPIGGVLFSIEVTSTFFAVRNYWRGFFAATFSAFI 288
gi 1742959   204 SLLGQGGSTkyhlnsr-wpqlfkSDRDRRDLVTCGCAAGVAAAFRAPVGGVLFALEEVTSWWRSQLMWRVFFTSAIVAVV 282
gi 12311826  278 AGVTQGRSRtlgfqts-mfqafrNNKDRRDFITAGAACGVSVAFGAPIGGLLFVMEEVSSFWDQSSNGQIFLATMLCFTF 356
gi 1705905   236 NIFSYLFPKys-----------tNEAKKREVLSAASAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALVAAFV 304
gi 4557475   178 AYLGRVRTTtig--------epeNKSKQNEMLVAAAAVGVATVFGAPFSGVLFSIEVMSSHFSVWDYWRGFFAATCGAFM 249
gi 68128735  275 AGLPTGRSRslgcsatsvfdlfrNPRDQRDFISAGAACGLTSAFSSPLGGMLFVLEEMATHFSVRLAWLVFLSCLSCMWI 354
gi 71745106  265 AGVTQGRSRalrcqts-lfqafrNNKDRRDFITAGAACGVSAAFGAPIGGLLFVMEEVSSFWDHSASGQIFLATMVCFSI 343
gi 74026320  268 AGLPTGRSRtlncgatsllstfrNPRDMRSFISAGAACGVTSAFSAPIGGLLFVMEEVATFFSVRLACMVFVSCLACMCV 347
gi 71748640  232 AQTLQRRRWiqiehvn-iiecfrNPRDRRTIVVIGAAAGIASAFNVSIGGLMVVVELISTTIPVRFALYVFAASLVSSLF 310
gi 71655201  255 AQALQRRRYfrcdsvh-iiecfrNPRDRRVITVIAAAAGVASAFGVSIGGLMVVVELISTILPVRFAIYVFAASLVSSLT 333
gi 68128937  214 SQLLQRRHGircyhvh-fvdyfrNPRDHRTVLVIGAAAGIAAAFCVSVGGLLVILELVSAVFPVRFALYVFAACLLSTLS 292
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 1705901   289 FRVlavwnrdeetit----------------alfktrfrldfpFDLQELPAFAVIGIASGFGGALFVYLNRKIVQVMRkq 352
gi 1742959   283 VRTamgwcksgicghfgg-----------ggfiiwdvsdgqddYYFKELLPMAVIGVIGGLLGALFNQLTLYMTSWRRns 351
gi 12311826  357 STIinsivegrrllgwvs-----------naaavlfevnitipLNLVSIIPSLFLGIIMGSLAAFFTKTNLILIKWRRrv 425
gi 1705905   305 LRSinpfgnsrlv---------------------lfyveyhtpWYLFELFPFILLGVFGGLWGAFFIRANIAWCRRRKst 363
gi 4557475   250 FRLlavfnseqetit----------------slyktsfrvdvpFDLPEIFFFVVLGGLCGILGSAYLFCQRIFFGFIRnn 313
gi 68128735  355 IQAcnsflsgwhlvdrsamalgdlreasiamfyidtvrentvsLYTYTFIPTVMVAVLSGLLAVAYTVSSIRFSRWRSrc 434
gi 71745106  344 ISIfrsviedqrllgwvs-----------navsvlfevnlsipLNVYSIAPSFFLGIVCGLFAALFTKVNIVLIKYRRrc 412
gi 74026320  348 IQIvnsymsgwhllaqspmthgeflpsaiamfivnnvpgnhvpLNVYTFIPTVVGSLALGLLAVLYTVSSVRFLRWRRer 427
gi 71748640  311 IQVyfshflyfagrdrtgyssgeliselvqvfastipfeqivrMHILYFIPTVVIGFICGALSGVYVRLSWFALVVRRhl 390
gi 71655201  334 LQIyfsffsyfslrdrhsyphgelisemvqffvscvsfedlvrMHIFYFIPTTLIGLFCGVLASVFVRLSSFALGLRRwl 413
gi 68128937  293 TQMywsycmnfdspyrlhggll---lrevvlfrshlpfgqhaaMNLMAYIPAFVIGLCSGACAVGFVRLSWVALYCRRll 369
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 1705901   353 ktinrflmrkRLLFPALVTLLISTLTFppgfgqfmagqlsqketlvtlfdnrt--------------------------- 405
gi 1742959   352 lhk--kgnrvKIIEACIISCITSAISFglpllrkcspcpesvpdsgiecprppgmygnyvnff----------------- 412
gi 12311826  426 lrp---cqfrRLLEPVVIGAVFSTCMYvlslvspcaelhdigtvnetvqqwgteggwrlfnnt----------------- 485
gi 1705905   364 kf-----gkyPVLEVIIVAAITAVIAFpnpytrlntselikelftdcgplesssl------------------------- 413
gi 4557475   314 rfsskllatsKPVYSALATLVLASITYppsagrflasrlsmkqhldslfdnhswal------------------------ 369
gi 68128735  435 lfp---talyRVLEPCVFASLFSTACYvmplftpcvptpphvrekkealnvelftafcaq-------------------- 491
gi 71745106  413 mrq---ssirRFLEPVVAITLYSLLSYffamlsgcapfqdmedrgdvlvwgtenttslftat------------------ 471
gi 74026320  428 lfp---ntflRVLEPCLFSLAYNTVCYvlplafgcieippyvkdhkaemkvelftefcad-------------------- 484
gi 71748640  391 eqrf-kvrafRALLPVAFTVAYVSLHYwmvvafgsagwsppssalnptdnttagglttlrwgnssavsphfvdtqsgpcv 469
gi 71655201  414 eqrl-etkavRYVLPVLFTGIYVTIHFwvaaavgsggwsppapspsepprigsdsirlpmlqqtmsnesnpaglhgamgg 492
gi 68128937  370 evrl-rtkviRYVLPILFTLVYVSVHYwvavafsaesgpgdtmpsavgadsnaqrsgsadplasssssdgadvgppavcr 448
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 1705901   406 -------------------------------------------------------------------wvrqglveelepp 418
gi 1742959   413 ----------------------------------------------------------cktdneyndlatiffntqddai 434
gi 12311826  486 ----------------------------------------------------------ctkpktysplgtlnmasgknti 507
gi 1705905   414 -----------------------------------------------------------------cdyrndmnaskivdd 428
gi 4557475   370 ----------------------------------------------------------------mtqnssppwpeeldpq 385
gi 68128735  492 ------------------------------------------------------------petthhplatltmtspynll 511
gi 71745106  472 ----------------------------------------------------------csenntfsplatlvlgserdti 493
gi 74026320  485 ------------------------------------------------------------rentfnplatlalmgpynsi 504
gi 71748640  470 avpqtlsdsrdv-----------------svisfygangffcaapnntvipvtatvheqqvwivlhsyaslafanadsal 532
gi 71655201  493 pcvavpstllttln-------------vtsisyygangffcsaptavedqvheerwgmkptlsvlhayaslafanadsav 559
gi 68128937  449 pvpytvrsgrnvttigfygmngflcpagsyrvvdavdiynaaehsnrvssvtktlprrqqtvrvvdayaslafsyadstl 528
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                              #####                                     
gi 1705901   419 stsqawnppranvFLTLVIFILMKFWMSALATTiPVPCGAFMPVFVIGAAFGRLVGESmaawfpdgih-------tdsst 491
gi 1742959   435 rnlfsaktmrefsAQSLLTFLAMFYTLAVVTFGtAVPAGQFVPGIMIGSTYGRLVGMFvvrfyk---------------k 499
gi 12311826  508 rhlfsrqtagefpVMTLIVYFLIYFASACMASGtSVSGGLVVPSLVLGAVFGRLFGLLmfhigvakipdv--prgyasad 585
gi 1705905   429 ipdrpagvgvysaIWQLCLALIFKIIMTVFTFGiKVPSGLFIPSMAIGAIAGRIVGIAveqlayyhhdwfifkewcevga 508
gi 4557475   386 hlwwewyhprftiFGTLAFFLVMKFWMLILATTiPMPAGYFMPIFVYGAAIGRLFGETlsfifpegiv-------aggit 458
gi 68128735  512 rllfsrrsvglfpAWSLFLHLAIYVVGSSYAGGmFISCGTVIPSLLIGAVEGRLIGVLfqrp------------------ 573
gi 71745106  494 rhlfsrqtiwqyhPVQLLVLLLLYTIFACWSNGmAISGGLVVPSLVIGAALGRLFGLFvcfvgmgnigve---rgymasl 570
gi 74026320  505 rvlfsrhttglipWYACLLQLMLYTFSSSYAGGmFVSCGTVIPSLFIGAMGGRLVGTLfnne------------------ 566
gi 71748640  533 qtllslrtetmlsLPVLMIFLLIYYTSSAIFLGiSPCGDTVFPTLVVGATVGRIVGLVvflivspg-----------srs 601
gi 71655201  560 qtllswhteemlgAPVLVIFLSIYFLASALFLGvSLGGDTLLPGLVIGAAVGRLFGIGvhyaavsvvg-------aeaas 632
gi 68128937  529 qtllsqrteyllpWPALLTFSVIYFFASAVYSGlALCGDIILPSLVIGAAIGRCIGAAvhsvavahs---------kdaa 599
                        570       580       590       600       610       620
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
Feature 1                                                                       # 
gi 1705901   492 yrivPGGYAVVGAAALAGAV-THTVSTAVIVFELTGqIAHILPVMIAVILANAVAQSLq-PSLYD 554
gi 1742959   500 lnieEGTYALLGAASFLGGSmRMTVSLCVIMVEITNnLKLLPLIMLVLLISKAVGDAFn-EGLYE 563
gi 12311826  586 awmdPGVFALIGAGAFLAGTsRMSMAICVIMVELSAeLHYLLPVMVAIVMSKTTADWLc-EPLYH 649
gi 1705905   509 dcitPGLYAMVGAAACLGGVtRMTVSLVVIVFELTGgLEYIVPLMAAVMTSKWVGDAFgrEGIYE 573
gi 4557475   459 npimPGGYALAGAAAFSGAV-THTISTALLAFEVTGqIVHALPVLMAVLAANAIAQSCq-PSFYD 521
gi 68128735  574 lwadEGVVALIGAAAYFAGIsRLTFALVVVMMELTAdVSHITCLMLGILLAKGIADKCc-HSFYH 637
gi 71745106  571 awmdPGLFALIGAGAFLAGItRMTMSICVIMMELSSeLHYLLPTMVAIIIAKAVAGLIa-EPLYH 634
gi 74026320  567 vwadPGVLSLIGAASYFSGIsRLSFSLIVIMMEMTAdLTHITCLMVGVVFARALADRFc-HSLYH 630
gi 71748640  602 swadPGIFALIGAGSFVGGTtGLAFSICTILMESTGqFQHMLPLMVGIMIAKKTAEIFt-HNINA 665
gi 71655201  633 swadPGCFALIGAGSFLGGTtGLTFSICTILMESTSdFQHLLPLMMGITIAKKTAELFt-QNINT 696
gi 68128937  600 twadPGVFALFGAGSFVSATsGLSFSIGAILIECTAdFRHLLPLMFSIAVARRVLLRWg-RDVHT 663

Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap