NCBI CDD Logo
?
cd03221: ABCF_EF-3 
ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth. EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Statistics
?
PSSM-Id: 72980
View PSSM: cd03221
Aligned: 109 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 12-Jan-2005
Updated: 15-Mar-2007
Structure
?
Aligned Rows:
Hierarchy
?
Display:

cd03221 is part of a hierarchy of related CD models.
Use the graphical representation to navigate this hierarchy.
cd00267:ABC_ATPasecd03213:ABCG_EPDRcd03214:ABC_Iron-Siderophores_B12_Hemincd03215:ABC_Carb_Monos_IIcd03216:ABC_Carb_Monos_Icd03217:ABC_FeS_Assemblycd03218:ABC_YhbGcd03219:ABC_Mj1267_LivG_branchedcd03220:ABC_KpsT_Wztcd03221:ABCF_EF-3cd03222:ABC_RNaseL_inhibitorcd03223:ABCD_peroxisomal_ALDPcd03224:ABC_TM1139_LivF_branchedcd03225:ABC_cobalt_CbiO_domain1cd03226:ABC_cobalt_CbiO_domain2cd03227:ABC_Class2cd03228:ABCC_MRP_Likecd03229:ABC_Class3cd03230:ABC_DR_subfamily_Acd03231:ABC_CcmA_heme_exportercd03232:ABCG_PDR_domain2cd03233:ABCG_PDR_domain1cd03234:ABCG_Whitecd03235:ABC_Metallic_Cationscd03236:ABC_RNaseL_inhibitor_domain1cd03237:ABC_RNaseL_inhibitor_domain2cd03238:ABC_UvrAcd03239:ABC_SMC_headcd03240:ABC_Rad50cd03241:ABC_RecNcd03242:ABC_RecFcd03243:ABC_MutS_homologscd03244:ABCC_MRP_domain2cd03245:ABCC_bacteriocin_exporterscd03246:ABCC_Protease_Secretioncd03247:ABCC_cytochrome_bdcd03248:ABCC_TAPcd03249:ABC_MTABC3_MDL1_MDL2cd03250:ABCC_MRP_domain1cd03251:ABCC_MsbAcd03252:ABCC_Hemolysincd03253:ABCC_ATM1_transportercd03254:ABCC_Glucan_exporter_likecd03255:ABC_MJ0796_LolCDE_FtsEcd03256:ABC_PhnC_transportercd03257:ABC_NikE_OppD_transporterscd03258:ABC_MetN_methionine_transportercd03259:ABC_Carb_Solutes_likecd03260:ABC_PstB_phosphate_transportercd03261:ABC_Org_Solvent_Resistantcd03262:ABC_HisP_GlnQcd03263:ABC_subfamily_Acd03264:ABC_drug_resistance_likecd03265:ABC_DrrAcd03266:ABC_NatA_sodium_exportercd03267:ABC_NatA_likecd03268:ABC_BcrA_bacitracin_resistcd03269:ABC_putative_ATPasecd03270:ABC_UvrA_Icd03271:ABC_UvrA_IIcd03272:ABC_SMC3_eukcd03273:ABC_SMC2_eukcd03274:ABC_SMC4_eukcd03275:ABC_SMC1_eukcd03276:ABC_SMC6_eukcd03277:ABC_SMC5_eukcd03278:ABC_SMC_barmotincd03279:ABC_sbcCDcd03280:ABC_MutS2cd03281:ABC_MSH5_eukcd03282:ABC_MSH4_eukcd03283:ABC_MutS-likecd03284:ABC_MutS1cd03285:ABC_MSH2_eukcd03286:ABC_MSH6_eukcd03287:ABC_MSH3_eukcd03288:ABCC_SUR2cd03289:ABCC_CFTR2cd03290:ABCC_SUR1_Ncd03291:ABCC_CFTR1cd03292:ABC_FtsE_transportercd03293:ABC_NrtD_SsuB_transporterscd03294:ABC_Pro_Gly_Betainecd03295:ABC_OpuCA_Osmoprotectioncd03296:ABC_CysA_sulfate_importercd03297:ABC_ModC_molybdenum_transportercd03298:ABC_ThiQ_thiamine_transportercd03299:ABC_ModC_likecd03300:ABC_PotA_Ncd03301:ABC_MalK_Ncd03369:ABCC_NFT1488563534907311048855480464466454644608534558488158962014690765934398087515735644745945830251205582126532475699265538104256067245656836212248151589626445657310216741261722879250514582506112425225565208055228284945189222328377148273835203346844121322647293759801273592309815449479288156144634886493545656289212248155582126542519355156728814252556324379260425606724885566642525563158938181567288142519355282849415614463230981542738352029375980158962592769708164133682837714812735915213983232040324163001940185621629307425428611264330628436765307254005379351450752367201520951755337246099576462292461408178292478314255491246098037136271051347236415893110425269114565683615806640341027312313062054295909425249183455668813591832475336564789241589620124114617134723654965721629247831216293071917365911698711264330646096971462292461408178425549124074682146098037488563534907311048855480464466454644608534558488158962014690765934398087515735644745945830251205582126532475699265538104256067245656836212248151589626445657310216741261722879250514582506112425225565208055228284945189222328377148273835203346844121322647293759801273592309815449479288156144634886493545656289212248155582126542519355156728814252556324379260425606724885566642525563158938181567288142519355282849415614463230981542738352029375980158962592769708164133682837714812735915213983232040324163001940185621629307425428611264330628436765307254005379351450752367201520951755337246099576462292461408178292478314255491246098037136271051347236415893110425269114565683615806640341027312313062054295909425249183455668813591832475336564789241589620124114617134723654965721629247831216293071917365911698711264330646096971462292461408178425549124074682146098037
cd03221 Sequence Cluster
cd03221 Sequence Cluster
Sub-family Hierarchy
Click to see CD Hierarchy help
 cd03221 Branch
 Whole Hierarchy
 [Download CDTree]
CD Hierarchy
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15213983  435 LCNCEFSLAYgak-ilLNRTRLRLKRgrRYGLCGPNGSGKSTLMRAIvng--qveGFPTHLr---TVYVEHdideseadt 508
gi 15806640   78 IALSHAAKEYgpl-tvLQDITFAVEPgdRVGLVGRNGAGKSTLLRLLtgqllpdgGEVRHApnvrARALQQdpvfpagat 156
gi 127359      6 IKFNQINHKLtdl-rsLNIDHLYAYQfeKIALIGGNGTGKTTLLNMIaqktkpesGTVETNg--eIQYFEQlnmdvendf 82
gi 21224815    4 LEAAHLEYYLpdgralLGDVSFRVGEgaVVALVGPNGAGKTTLLRLLagelkphgGTVAVGg--gLGVMRQfvgsvrdet 81
gi 23098154    6 FELENIELTYldk-eiLKIDRLAIHQfdRIGIVGKNGSGKSSLLKLLagkikpnkGIVHQHa--sYAYFEQmeapdlhlt 82
gi 15896259    4 LEINNLKKYFkdr-liLEINNLKIYSgdKIGVVGVNGAGKTTLLNILsgkikaeeGVVKLQa--sYSYISQlddmys--- 77
gi 16413368    4 IEINQLKIEIgdr-tlVEIPHLLVDKkaRIGIIGQNGLGKTTLMEVIagvkeatsGNITSYg--kLAYIKQlhtd----- 75
gi 2769708     4 IDMKNVKKYYadk-liLNIKELKIYSgdKIGIVGKNGVGKTTLLKIIkglieideGNIIISekttIKYISQleephskii 82
gi 27383520    5 IKARNIRLDYagr-dvLDIDELEIHSydRIGLVGDNGAGKSSLLKVLngeivlaeATLQRFg--dFAHISQlggieietv 81
gi 28377148    4 INLKNIQKDMagr-plFTIDRLVANAgdKIGVVGRNGAGKSTLAHLLtgtdrdytGQIMVDe--pVSYVAQiap------ 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15213983  509 psvdfilqdpavpikd-----------------------------------------rdeivkalkensftdelinmpig 547
gi 15806640  157 idtvlesafrdldaleaelaaaaaamssgseaa------ilhhealleqfarrggyerrsrkeqvtlafgfrgrehdpvt 230
gi 127359     83 ntldgs-------------------------------------------------------------lmselhipmhttd 101
gi 21224815   82 tvrdllvsvapprireaaravdtaehaimtvddeaaqltyaqalsdwaeargyeaetlwdmcttaalgmpydkaqwrqvr 161
gi 23098154   83 gnedp--------------------------------------------------------------allgklhvpsqld 100
gi 15896259   78 ----------------------------------------------------------------------------qrek 81
gi 16413368   76 ------------------------------------------------------------------------------ks 77
gi 2769708    83 dgky----------------------------------------------------------------asifqvenkwnd 98
gi 27383520   82 edram---------------------------------------------------------------lsrlgvsnvqnd 98
gi 28377148   75 ------------------------------------------------------------------------------tf 76
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 15213983  548 sLSGGWKMKLALTRAMFKnPDILLLDEPTNHLDvvnvawLENFLVNQKDvsSIIVSHDSGFLdhvvqaIIHYEr-FK 623
gi 15806640  231 gLSGGERTRLGLAALLVEnPDVLLLDEPTNHLDivmvewLEGFLGRYPGa-VLVISHDRQFLdnvtkeTAYLRg-GT 305
gi 127359    102 sMSGGEKAKYKLANVISNySPILLLDEPTNHLDkigkdyLNNILKYYYGt-LIIVSHDRALIdqiadtIWDIQedGT 177
gi 21224815  162 tLSGGEQKRLVLEALLRGtDEVLLLDEPDNYLDvpgkrwLEERLAETRKt-VLFVSHDRELLaraaekIVSVEp-GP 236
gi 23098154  101 sISGGEQTRLKLTQLLSEyREALFIDEPTTHLDqdgvafIQSELEYYYGa-LVLVSHDRTLLdqlvstIWEIHd-GS 175
gi 15896259   82 nLSGGERTKLKIKNSFKEnAEILMADEPTANLDiaasnkLEKMLLDFNGa-LILVSHDRELLdkvcnkIIEIEn-GK 156
gi 16413368   78 tQSGGEKTRKAIQHAMRQnPSILLADEPTSNLDvesvkhLERQWSDFHGa-LMIISHDRAFLdalcteIWEIKn-QE 152
gi 2769708    99 nMSGGEKTRFKLAEGFQDqCSLMLVDEPTSNLDiegielITNTFKEYRDt-FLVVSHDRIFLdqvctkIFEIEn-GY 173
gi 27383520   99 tMSGGEETRAKIAAAFSQqVHGILADEPTSHLDlngidlLIGQLKAFDGa-LLVISHDRYFLdmvvdkIWELKd-GK 173
gi 28377148   77 dQSGGQAMLTRIRQALSArPTILILDEPSSNLDethqqwLINQLQRFRGl-LLLISHDRQLLnavttqTWAVEh-QK 151
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap