Conserved Protein Domain Family
COG5580

?
COG5580: COG5580 
Activator of HSP90 ATPase [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 35139
View PSSM: COG5580
Aligned: 4 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 7-Oct-2002
Updated: 7-Oct-2002
Structure
?
Aligned Rows:
COG5580 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320420    1 MVVN--NPNNWHWVDKNCIGWAKEYFKQKLVGVEAGSVKDKKYAKIKSVSSIEGDCEVNQRKGKVISLFDLKITVLIEGh 78
gi 19074553   1 MNEK--G-SNYHWAESDISAWAKEEISEALKSRGYEVHEMDVMVKICQRMSTLG-------------LV-YMISFECTK- 62
gi 19112673   1 MSATsiNPNNWHWTSKDCRVWSHEYFNKELPKIQAS--EGPTSARITQVNSCEGDVDVSMRKRKVITIFDLKIQMEFKG- 77
gi 1730645    1 MVVL--NPNNWHWVDKNTLPWSKDYLNGKLTSLSTVSSDGKSKIELTQVSSITGDSNVSQRKGKPICYFDLQLSMNVKVt 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320420   79 v-----dsKDGSALPFEGSINVPEVAFDseassyQFDISIFKETSELSEAkpLIRSELLPKLRQIFQQFGKDLLATHGND 153
gi 19074553  63 ---------DGRYCGVRNFYSVSEKAEG------MEDFEWFPGFFKEMEG-----EAVLKFGNRVLDVNREVERKPCARN 122
gi 19112673  78 --------ETKDGVEATGSITCPELSYDlgysdyVFDIDIYSASKEKEPIkeLVREKIIPQIRQLFSGFSQVLLQTHGDD 149
gi 1730645   79 nldtnkddEDDDGILADGKLEIPEFMHD------ESDIPILSQGFDAFDG--LVRSEFVPKVVETLLKYQDDLIKEHSKD 150
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320420  154 IQVPESQvksnytrgnqkssfteikdsaskpkknalpsststsapvsstnkvpqngsgnSTSIYLEPTFNVPSSELYETF 233
gi 19074553 123 ITAEDAR----------------------------------------------------TADMIYKASINCEVDELKNFI 150
gi 19112673 150 VYLSTEEhngnaarglpvhssfkqnnssqts----snkgtttvaagsgsdgsrvsavvnTADISENYTFDAPANELYATF 225
gi 1730645  151 IQV----------------------------------------------------------------------------- 153
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320420  234 LDKQRILAWTRSAQFFNSGPKletkekfeLFGGNVISELVscEKDKKLVFHWKLKDWSapfnSTIEMTFHESQEFHETKL 313
gi 19074553 151 LSHEYISVWSGSRAMFEGDDI--------LIDGVVIRRLR--EKDGEIRMEWKLREWS----DFTDAKIMLEPYLSSSKI 216
gi 19112673 226 LDPARVAAWSRAPPQLDVRPQga----fsLFHGNVVGKFLvlEENKKIVQTWRLSSWpt--gHYAEITFTFDQADSYTTL 299
gi 1730645      --------------------------------------------------------------------------------
                       330       340       350
                ....*....|....*....|....*....|....*..
gi 6320420  314 QVKWTGIPVGEEDRVRANFEEYYVRSIKLTFGFGAVL 350
gi 19074553 217 TVKQRNIPIKEEGSIRMWWQERMFTPISACFGFVLRP 253
gi 19112673 300 RMIMKGVPIGEEEVVQGNIQDYYIRPIKTVFGFGAVL 336
gi 1730645      -------------------------------------
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap