NCBI CDD Logo
?
COG0811: TolQ 
Biopolymer transport proteins [Intracellular trafficking and secretion]
Statistics
?
PSSM-Id: 31153
View PSSM: COG0811
Aligned: 71 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 7-Oct-2002
Updated: 7-Oct-2002
Structure
?
Aligned Rows:

COG0811 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15887516 110 MFMAADWVVKGVMIGLAFASLVTWTVWVAKSIELAGARVRAGSTL-KVIRRAKTLAEATDAVE---NKG-GPAALMLRMA 184
gi 15605326  12 SFQEADLFGKVIFFSLFALSICTWTVLHQKLSIQKKFLKSGKSLK-EFLIKNRHSPLSLDIHPe-sTPFtDLYFTIKRGT 89
gi 15791497   1 -MNFEAIFHFFNSSSIITYIVLLWLSLYFILAFSILFARLTYLAT-WRNKEKESLETLLLGEK----D--LSRTDSILRK 72
gi 3915401    2 FLDPVINFFGTVLEMFRSGGVITYLIAAIGIYGFITALEKIHYLRkISRVSTPQIIGAVNESMe--kGGaLEALREIGQY 79
gi 15678698   4 VPGSEILSGALHVVSQSLLIPVIAGLLLFMVYAIVTLGGLISEYSgRIRTDVKELESAIKSISn-pGTPeKIIEVVDSMD 82
gi 15597120   1 -----------------------------------MNGLETSLYElTRLFLLPVLLLILAALAy-----aFVALGGFAME 40
gi 17546683   9 LWTQGDIVARGTALLLLLMSLASWIVILTKAWDLIRLKSMAQGAE-KRFWHSDDFDHAMHTLGspkDNPfYALAQTGREA 87
gi 15641554   1 ----------------MMNSAFSFLLDYWQPLDEFMAQGGAVLWWlAVVVLLCWLLVIERLLFl-----sVTFPKQRQHW 59
gi 15606982   1 --------MEAILAWIEKGGIVMYPLILLSILSWYVIIERAVNLRvKNFLPRNLTEIKALISRg-dYESaLKISTVVDHP 71
gi 3913624    1 ---------MNPIELMQKGGVAMWPLLLLSILSVSTIIERLWFWG-QVILKSSQTASRILDTAa--RDWdTAIRVAQDSR 68
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15887516 185 THEMQLSDAVVEHTDGGg---IKERVSSALSRIETHAGRRMSRGTGALATIGSTAPFVGLFGTVWGIMNSFISIS-ESQT 260
gi 15605326  90 LELLDKNRQLAPERTPLlsveDIQSLETLFNAVMPKYRALLNKNNFIPATTISLAPFLGLLGTVWGILLAFAHIS--TGQ 167
gi 15791497  73 CNDTTS--NH-------------------LEIYKNLASRRASAGLTWLSIIASTSPFIGLFGTVISILETFGGLG-T--Q 128
gi 3915401   80 QNPVSKIISEALKIGYR----NRSEVEDAMERVFIVEMSNMTRGLGTLRTIIEVAPMLGLIGTVIGIWYTFRALG---VN 152
gi 15678698  83 IPQSQKAVLTDIAGTAEl--gPKSR-EALARKLIENEELRAAKSLEKTDIVTRLGPTLGLMGTLIPMGPGLAALG---AG 156
gi 15597120  41 AWQRRRGRYRSR----------LAAWQALHGGNSDDLELWIMQRLEWLRITSRSAPMLGLVATMIPMGPALLALT---RN 107
gi 17546683  88 AQHHRASHPQLHD-VMD----ISDWITRSLKSAIDESVGQMQSGLAVLASVGSTAPFVGLFGTVWGIYHALIGIGaVGVP 162
gi 15641554  60 VDLWLQRADQHS-----------WFARSIREQWLGEAHNALNQNLNLIKVLVAICPMLGLLGTVTGMISVFDVMAtQGSS 128
gi 15606982  72 FTKAVSVTLEEYLKGKK----EKGYLIRLMEEELSALVPKIEKNLPILSTTASVAPLLGLFGTITGLIKVFQAYAiTTQG 147
gi 3913624   69 RFPIAKYLLAPLRLPHP----DPEVFHLALESAADDQLALMRRGDKILEAIIALSPLLGLLGTVLGLIQSLSSIQiSDLG 144
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 15887516 261 -TNLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARSITGYRHLLADAAAGVERLVSRDLDFR 323
gi 15605326 168 -ANGTIMMEGLATALGTTIVGLFVAIPSLVGFNYLRAHAFQVSLEIEQTAFLLLNSIEVKYRQT 230
gi 15791497 129 -NSLSIIAPKISEALVATGCGILVAIPAYTFHLIIKRKAFELLSIIDSEIKVISSSK------- 184
gi 3915401  153 -ADPAAMAEGIYVALITTILGLAVAIILMPLYSYITGRIDDEIDKIELIKKMTNWGYAVMRISV 215
gi 15678698 157 --DINTLAQAIIIAFDTTVVGLASGGIAYIISKVRRRWYEEYLSNLETMAEAVLEVMDNATQTP 218
gi 15597120 108 --DAQGIGENLVVAFSAVILALVAASITFFILTVRRRWLLQELRAVERAREAG----------- 158
gi 17546683 163 --TIDKVAGPVGESLIMTAFGLAVAIPAVLGYNALTRGNKSVIAKLNRFAHDLHAYFVTGARLR 224
gi 15641554 129 --DPKLMASGISLATLPTMAGMVAALAGLFVHARLSKTCRGLEMKLEQALRSQS---------- 180
gi 15606982 148 -EAMNLLAKGISEVLVAAATGLGVAIPALLAYWVYKAIGNHILDRISEEAREIIHSLE------ 204
gi 3913624  145 tASTAGVTLGIGEALISTAAGLIIAIVSLAFYRVFQGLWFNQMRVFRKVGSELEVLYRQRwfee 208
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap