Conserved Protein Domain Family
FIIND

?
pfam13553: FIIND 
Function to find
The function to find (FIIND) was initially discovered in two proteins, NLRP1 (aka NALP1, CARD7, NAC, DEFCAP) and CARD8 (aka TUCAN, Cardinal). NLRP1 is a member of the Nod-like receptor (NLR) protein superfamily and is involved in apoptosis and inflammation. To date, it is the only NLR protein known to have a FIIND domain. The FIIND domain is also present in the CARD8 protein where, like in NLRP1, it is followed by a C-terminal CARD domain. Both proteins are described to form an "inflammasome", a macro-molecular complex able to process caspase 1 and activate pro-IL1beta. The FIIND domain is present in only a very small subset of the kingdom of life, comprising primates, rodents (mouse, rat), carnivores (dog) and a few more, such as horse. The function of this domain is yet to be determined. Publications describing the newly discovered NLRP1 protein failed to identify it as a separate domain; for example, it was taken as part of the adjacent leucine rich repeat domain (LRR). Upon discovery of CARD8 it was noted that the N-terminal region shared significant sequence identity with an undescribed region in NLRP1. Before getting its final name, FIIND, this domain was termed NALP1-associated domain (NAD).
Statistics
?
PSSM-Id: 290286
View PSSM: pfam13553
Aligned: 39 rows
Threshold Bit Score: 260.213
Threshold Setting Gi: 658834562
Created: 30-Jun-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam13553 is a member of the superfamily cl16302.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67460451   72 VRFPTAGWYLWPATGLGFLVRDVVTLTIGFGSWNQHLALDLQHHeqWLVGGPLFDITA---E-PeEAVAEIHLPHFISLQ 147
gi 525007610 111 VQLDAEGSYQCSITGLIFEVTGAARITYSLLSWSKYA-QLVEEP--WIVGGPLFDVRCs--A-P-ALLSSLQFPHCLCLQ 183
gi 823418900 185 LKLDTEGTYQCTETGLIFEVNRKVDIKYCVLSWSKYADLVVKP---WVVGGPLFDVKC---D-P-TCLISIQFPHSLCL- 255
gi 556997434 161 lmLEDEGSYQCTVTGLIFEVSQKAHIKYSVLSWNKYSEDLKTP---WIVAGPIFDVNC---G-P-AILKSIHFPHSLCL- 231
gi 513200097 143 MKLDAEGTYECSVTGLIFDVTKAVTINYSLLSWSKYAGLVEPP---WVVGGPLFDVRC---EaP-SALTSIAFPHSLCLG 215
gi 597790204   5 lmLKYEGVYECSETGLVFEVSEKVQIRYCVLSWSKFGTYL-NES--WKFAGPIFDVDC---D-P-SILKSIQFPHSLCL- 75
gi 565322039  89 LKLDGEGTFECTETGLIFEVTRSITIEYSVLSWTKYASYVKEP---WIVVGPIFDIKC---T-S-SALTSIQFPHTLCL- 159
gi 688586741 109 LQLDAEGVYECSDTGLVFEVSQRVKITYCVLSWSRFSTYLTGS---WKFAGPIFDVDC---D-P-AILKSIQFPHSLCLA 180
gi 551513105  32 LALEGEGTYECSVTGLVFQASEPVLVRYSILSWSKFGSFL-PNS--WKFAGPIFNVDTvnkD-A-SVLTSIQFPHSICL- 105
gi 542252300  22 FQCSCAGLYQCSVTGLVFDMKAEGDVVYRTVPWNMRL--LTRHH--KKPAGPLFDIKC---Q-Q-QSVCQLHLPH--CEI 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67460451  148 AGEVDVSWFLIAHFKNEGMVLEHPARVEPFYAVLEKPSFSLMGILLRiaSGTRLSIPITSNTLIYYH--P--HPED-I-- 220
gi 525007610 184 E-HGAGVAFKLLHVKESGAAIEPSAEFSASHVKWLVTSLSPVGPLIQ----SQQPLQYHGAVILYKA--I--DEHP-Sl- 252
gi 823418900 256 GHHDANMTFKVLHVKSSGASLESTVDHSTTHVKWRVSSLSPVGPVIQ----SEETVYHHGAVILYKA--I--DHNP-Sl- 325
gi 556997434 232 GDHLSNVKTGVLHIKNGSPVIEPSSDLSATHVKWNVSSLSPVGPVIQ----TSEPIQHHGVVLLYKV--I--NNYP-Sl- 301
gi 513200097 216 DG-GSHPAFKVLHIKGAGAAIEPSMDFSASHVRWLVSSLSPVGPLIR----SEEPLLYHGAVVLYKA--I--DDDP-S-- 283
gi 597790204  76 ADQDNEMRFSVLHVKNNRGLIEPSVDHSRSHIKWSVSSLSPVGPIVQ----TTKPAEHHGVVLVYKE--V--GQTD-Sy- 145
gi 565322039 160 NDQLSEKAFKVFHFKKNCPEFEGSIDHSTTHVKWHVSSLSPVGPVIE----RYDPVYYHGVVILYKV--I--NNHP-Sl- 229
gi 688586741 181 ADKDNEVNFSVLHVKNSRGLIEPSSDHSGSHVKWTVSSLSPVGPVVQ----TSRSAEHHGVVQVFRE--L--GLES-Ssf 251
gi 551513105 106 AHPEEDLTFSVLHVKDNRPLIEPTADHSGSHVKWNVTSLSPVGPIIQ----KSGSVEHHGVVLVYKQ--LgsDANN-Y-- 176
gi 542252300  91 ISTGGGRFLEVAHVDDEGIECITPHQITETHVVINITGFSCYGIF-R--DDTSLPGPVKALIFLFYKplV--DSHPrS-- 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67460451  221 K-FHLYLVPSDALLTKMIDDEED--R-------FC--GVRLQTSPPVE-PLNFGARYIVSNSAH---LEIIPTELKLSYR 284
gi 525007610 253 S-FWVYLATNNDSFIKDISKEVK--H-------SKrkFVKIEKPAVCQkLLQEGKKYRLICEPE---AEITPVEIEFVDG 319
gi 823418900 326 S-FRVYIATNNESFIKDISKSVK--Hs-----sKR--FMKIDKPPVCQkLLQNGKKYRLISEPE---AEITPEEIEFVDG 392
gi 556997434 302 S-FSVYVAANNDSVIKDISKAQK--Q-------SKkkFIKIDKPPACQkSLQAGRKYRLISEPE---AEINPQEIEFFDQ 368
gi 513200097 284 LlFRVYVATNNDSFIKDISRAVKhsK-------KK--FIKIDKPPVCQkLLQNGKRYRLICEPE---AEITPEEIEFVDG 351
gi 597790204 146 S-FRVYLVTNNDSDIKDIQREVKnsK-------KR--YMKIEKPPTCQkLLEENKKYRLVSDPE---GDISPEDIQFTL- 211
gi 565322039 230 K-FRVYIATNNNSFIKDISKTVR--Rs-----lNK--FIKIEKPPCHK-LLQNGKKYRLTSDPE---ADITPEEIQFGDD 295
gi 688586741 252 S-FRVYLARNICSDIKDIRKAVR--RanncknnKK--YILVDKPPTC--MLEENRKYRLISEPV---GHITPEDMLFTPD 321
gi 551513105 177 S-FHVYLATNSSSDIKDIGKQVRgyK-------NR--YMKIDKPPTCK--LDEGT-YRLVSEPE---GEIKPEELKFTL- 239
gi 542252300 164 V-LSVLLLPRNVVIRHVLRTRKE--L-------NGe-EMYIDTPSRC--SLFPNQVYTLSTVPDddlIVVQPNEAEFHEE 230
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 67460451  285 SPGEIQHFSKFYAGQMKEPIQLEITEKRHETLVWKTVVKPVD 326
gi 525007610 320 SLLKLKSYFEVYLEKP-DDFTLSLVEQDSDETVWKAKLRERD 360
gi 823418900 393 SLLKLKSYIEVYLEQPVE-FKLLLVEMDSEEIVWKAKLRECD 433
gi 556997434 369 SSLKLKNYIEVYFEQPVE-FKLSLKEVLSDENVWTAKLRPCD 409
gi 513200097 352 SLLKLKSYIEVYFEKP-DDFTLSLVELDSGAPVWKAKLRESD 392
gi 597790204 212 AVVKIKGYFEAFFEQR-PPFKLSLIETESEQTVWSATIREGD 252
gi 565322039 296 STLAEKPFFEVYLEQPMELI-LSLVDLESEEVVWKAKLRESD 336
gi 688586741 322 S-VEVKGYIEVFFEDSPP-FKLSLTDADSGQTVWTSTIREGD 361
gi 551513105 240 AVTKMKGYFEAFFEERPP-FKLSLIEINTDETVWSATIREGD 280
gi 542252300 231 YFNSSVPSFQVIFKRDITDVNLSLTHQNSSSCVWKSEVcllp 272
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap