Conserved Protein Domain Family
FPN1

?
pfam06963: FPN1 
Ferroportin1 (FPN1)
This family represents a conserved region approximately 100 residues long within eukaryotic Ferroportin1 (FPN1), a protein that may play a role in iron export from the cell. This family may represent a number of transmembrane regions in Ferroportin1.
Statistics
?
PSSM-Id: 284400
View PSSM: pfam06963
Aligned: 16 rows
Threshold Bit Score: 430.952
Threshold Setting Gi: 268566197
Created: 16-Jul-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam06963 is a member of the superfamily cl06147.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48428687   22 TSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGnSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLK--VAQTSLVVQ 99
gi 75162463  146 PEGLYVLYASCLVGNLVEQLWNFAWPSAIAMLYP-SLLPVAVMGFVTKLAIIAGGPVVGKFMDYSPRVP--TYISLNVIQ 222
gi 74703169   82 ARGTLLLAVQHATLSWGYRSAEFAYPLMMVQLFTnTLLPASIYGFVTTAGAILFSNNVGRLIDTYAHLKlrTLRAMILSQ 161
gi 74594083   19 NRVLLRLYTSHFLSTWNSRMFEFGAVVFLASIFPgTLLYASVYALVRSLFAVLFSSWLGSLVDRTDRLS--AIRHSIIWQ 96
gi 121741408  44 KHVLFRLYVSHTLSTWNSRMFEFGSVLFLASIFPgTLLYASIYALGRSLSAVLLSSWLGSMVDRSNRLT--TIRHSII-- 119
gi 48428684   19 KSAKFLIYVGHALSTWGDRMWNFAVAVFLVELYGnSLLLTAVYGLVVAGSVLLLGAIIGDWVDKNPRLK--VAQTSLVVQ 96
gi 75015581    5 SGKELQLNSAFLLTTLGDRMWAFVIGLFMHQLg--GMTWVAVQQLVDSVLKLVVITIVGQYLDKIDRSK--IIQRTLLLN 80
gi 121713924  39 KHVLARLYVSHFLSTWNSRMFEFGAILFLASIFQdTLLYASVYALARSLSAVVLSSWLGSRMDHSDRLV--TIRRSIIWQ 116
gi 551522418 108 KGPKFLIYVSGALSMWGDRMWHFAISVFLIELYGrNLLLTAVFGLVLAGSVLLLGALIGDWVDRNPRNK--VAHASLFIQ 185
gi 145249824  42 TRILFRLYISHFLSTWNSRMFEFGAVLFLATIFPgTLRYTSVYALVRSLSAVVLSSWLGSVVDRANRLR--AIRHSIIWQ 119
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48428687  100 NVSVILCGIILMMVFLHKHELL---Tmy----------hGWVLTSCYILIITIANIANLASTATAITIQRDWIVVVA-GE 165
gi 75162463  223 AAAQVLSAGMIIHAYTVPSTSA---S-------------SILLQPWFFALLFAGAIDSLCGIASGVAIERDWVVLLAgIN 286
gi 74703169  162 KLLVGASYGLFLILFSSTSLRM---EaenggkgpqdaraNARPWVFFAAITLLGIGVMLSNVGVSVGVEREWVTIIS-DG 237
gi 74594083   97 RIPVAVSCVCLGLLLRSPP--------------------GHLSRLLFIALVLLAGVEKLAATVNTVSVERDWAVVIS-ET 155
gi 121741408 120 ----AASCACFVHLLNRSSEL------------------TYFSPLLFTAIALLACVEKLAANVNTVSVERDWAVVIS-DA 176
gi 48428684   97 NSAVILCGALLMAVFQFKQQLS---Smy----------dGWLLTTCYIMVISIANIANLASTAMSITIQRDWVVVVA-GD 162
gi 75015581   81 NAAVAVSAGLFAYMFVHKT--------------------DHYATPVLLMASAVASIAKVASEIQRISFTKDWVVVIS-QS 139
gi 121713924 117 RLPVVLSCACFVVLLVPSLMGN---K-------------F-VTWGLFAAVLLLACVEKLAAIANTVAVERDWAIIVS-DS 178
gi 551522418 186 NTSVTVCSIVLMLVFSYKEQIEliwD-------------GWFTVVCYTVVIILADVANLASTALTIAIQRDWIVVIT-GY 251
gi 145249824 120 RIPVAASCACFTVLLAPTTT--------------------AITSLVFAGTVLLACVEKLAATANCVAVERDWAIVVS-DA 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48428687  166 DRSKLANMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLKE-E-- 242
gi 75162463  287 RPIALAQANAVLHRIDLLCEIAGTMLFGILLSKYDPVTCLKFAATLMVGSLPTMTALIWLTNKFSSGVLDRPKCSLnS-- 364
gi 74703169  238 SSARLTRLNAIMRRIDLISKLVSPLFVSALTSTMGYTLAAVVLFSVNAVTGIFELIFVGTVYRRFPSLANDEKVAIaR-- 315
gi 74594083  156 LLVSRKDLNASMRRIDLFCKLVAPVVVSLMDGLLSTKVAIWAVLGVNVTVVLVEYFAIAGVYHSVPQLDRSHERQAaD-- 233
gi 121741408 177 LQYSRQGLNASMRRIDLICKLLAPVVISFLDG-FSTRAAIWTVLGVNVSCVVVEYIAIAQVYKVVPELERHRDASEnE-- 253
gi 48428684  163 DRSKLADMNATVRIIDQLTNILAPMLVGQIMAFGSHFIGCGFISGWNLFSMCLEYFLLWKVYQKTPALAFKAGQKDsD-- 240
gi 75015581  140 ESVDLAKVNSILLCIDQISSAILPTLTGELLDTFKWQYVCGFIIVYNLASWVIESMILRRLYNETPQLKTRASEITgD-- 217
gi 121713924 179 LAIQRQDLNASMRQIDLFCKLLAPLMVSLIDS-LSTSIAVWLVLAVNILCVFVEYVAIAQVYEAIPELRRVQRGLAtN-- 255
gi 551522418 252 NRGHLAGMNATMRRIDQVTNILAPLAVGQVMTLASNVVGCGFILAWNLFSLIVEFFFLSRVYRIVPALSVKPPTVEgDqe 331
gi 145249824 179 LDIPRQDLNASMRRIDLFCKLLAPVVISVIDG-LSTKIAIWTVLVVNVSCVVLEYIAIAQVYTSIPELKRCQDESSeI-- 255
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48428687  243 -----------------------ETELK-QlnlhkdtepkplegthlmgvkdsniheleheqEPTCASQMAEPFRTFRDG 298
gi 75162463  365 -----------------------CSAEG-S--------------------------------RTNTDSIFDIGMETIKLG 388
gi 74703169  316 -----------------------RQTAA-Eastdssacrepsl-------saqgtkarlaklTSLLVASVVEDVKQQYHD 364
gi 74594083  234 -----------------------DEEDE-Qqp----------------------------leEHLAQNIFAQYIRRTVAP 261
gi 121741408 254 -----------------------EDGAN-Hvqd--------------------------snsHRAGIYSVVRYIHRAVAP 283
gi 48428684  241 -----------------------DQELK-Hlniqkeigntespv----easqlmtessepkkDTGCCYQMAEPIRTFKDG 292
gi 75015581  218 -----------------------EE--------------------------------------LRGLKGVKLNSITQ--- 233
gi 121713924 256 -----------------------DGENG-Eddfqp----------------------tsravQRSVVNRAARLLNHVAAP 289
gi 551522418 332 ylarterrglqgthvlsqqdffnCNTDM-Hlke--------------------------itnLPLCFQRFRWLLSTCMDG 384
gi 145249824 256 -----------------------GDGPGlEpqd--------------------------ggsAPTAARRIAQYSRKALAP 286
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48428687  299 WVSYYNQPVFLAGMGLAFLYMT-VLGFDCITTGYAYTQ-GLSGSILSILMGASAITGIMGTVAFTWLRRKCGLVRTGLIS 376
gi 75162463  389 WKEYIQQPVLPASLAYVLLYFNiVLTPGSLMTAFLTQR-CVNPSVIGGFSGLCAVMGVAATFLSANLVKRVGILKAGAVG 467
gi 74703169  365 WKLFVRLPIFLTSLCISLLYMS-VLSFDPTFIAYLKSEtLYSDAFIAGMRAVGVVTGLMGTFAMPLLEKRIGLVRTGSYS 443
gi 74594083  262 WREYVGQSVFLASFALSLLYLT-VLSFGPTMVTFLLHS-GFSSLDVSAMRIGAVLTEISGTWMAPLLMDRIGPIRSGLWF 339
gi 121741408 284 WKEYVSSRVFLASFSLSLLYLT-VLSFGTTMVTYLLHT-GFSALEVSCMRIGAVVAELSGTWAAPIVMNRIGPIRSGLWF 361
gi 48428684  293 WVAYYNQSIFFAGMSLAFLYMT-VLGFDCITTGYAYTQ-GLNGSVLSLLMGASAVSGICGTVAFTWIRKKCGLIRTGFIA 370
gi 75015581  234 ---YFKQQSWTAGFGLSLLYMT-VLGFDNLAASYGQKH-GLSASYIGVLRGFGSALGVIGTFSFQFVAKRFGLLWTVMIG 308
gi 121713924 290 WREYIASPVFLASFSLSLLYLT-VLSFGPTMVTFLLHT-EYTSLQVSCMRVGSVIAELSGTWVAPFVMDKVGPIRSGLWF 367
gi 551522418 385 WRAYYRQPVFLAGLGLAFLYTT-VLGFDCITTGYAYTQ-GISGSLLSLLMGVSAITGLMGTVMFTRLRKSVGLVNTGIIS 462
gi 145249824 287 WREYVASSVFLASLALSLLYLT-VLSFGTTMVTYLLHT-GFTPLQVSGMRIGAVIAELSGTWAAPFITGRIGPIRSGLWF 364
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48428687  377 GLAQLSCLILCVISVFMPGSPldlsvspfedirsrfiqgesitptkipeitteiymsngsnsanivpetspesvPIISVS 456
gi 75162463  468 LFFQASLLAVAVAVYCSSSLS-----------------------------------------------------HKSPLF 494
gi 74703169  444 LFAELIPLVPAVVSLWITGSPsdrfgl------------------------------------------sdkrrSNWNTG 481
gi 74594083  340 LNWQFGTLAAAVAAFAFASDR-----------------------------------------------------PRLVAG 366
gi 121741408 362 LNWQFGCLAAAVAGFAFLERN-----------------------------------------------------SQVVAV 388
gi 48428684  371 GVTQLSCLTLCVASVFAPGSPfdlsvspfeevlrhlfgdsgslres---ptfiptteppiqanvtvfeeappveSYMSVG 447
gi 75015581  309 LVWQNIFIEMCGVSVLLPGSSmdvsgyiantsvsewskev---------------lsrvsnpepqnvpsvsfydVALPVN 373
gi 121713924 368 LNWQFTCLSAVAAAFALTDAT-----------------------------------------------------SRLVLV 394
gi 551522418 463 SCLHLGCLLLCVCSVFAPGSPidlsllmpyfssgssadpggmpllp----drssihwtnntvlfdnvpsgtapdSYISII 538
gi 145249824 365 LNWQFACLAAAVAAFAFLDNQ-----------------------------------------------------SQVVAV 391
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48428687  457 LLFAGVIAARIGLWSFDLTVTQLLQE-------NVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVLISVS 529
gi 75162463  495 FFLSMIVLSRLGHMSYGVVGAQILQT-------GIPSSKANLIGATEISVASLAESLMLGVAIAANDASHFGFLAVLSLL 567
gi 74703169  482 LLFSGLALSRIGLWAFDLTQLAMIQTalspeqlGPDAGRKNALMALQFSLQNVFDLGHYGLTLGWNKPQEFKYAATVSLV 561
gi 74594083  367 CLITGVALSRLGLWGFDLSVQFLVQE-------NIDPSSRARFSATEMALQSVFEMISFATTIFFADPDQFKYPVYISYG 439
gi 121741408 389 SLIVGVALSRIGLWGFDLSVQFLIQD-------GIAEHERARFSSTEMALQNIFELLSFATTIVFSRPEQFKYPVFISYG 461
gi 48428684  448 LLFAGVIAARVGLWSFDLTVTQLIQE-------NVIESERGVINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVIISVS 520
gi 75015581  374 LFFIGISFARFGLWLADPAITQIQQE-------TIPESQRYMAFTVQIALNEVFSILKDIIVIMFPFTPLFGVLTLGSCV 446
gi 121713924 395 GLIVGVALSRVGLWGFHLSAQFLIQE-------GVEEETRGQFSSTEMAVQNIFEMLSFATTIAFPLPEQFKYPVFISYG 467
gi 551522418 539 LLFLGVITARIGLWCFDLTVTQLLQE-------TICESERGVVNGVQSSMNYLMDLLHFIMVISAPQPQHFGILVIISVI 611
gi 145249824 392 SLIVGVALSRIGLWGFDLSVQFLVQE-------GVDERARARFSSTEMALQNIFELLSFATTIAFPLPEQFKYPVFISYG 464

                 ..
gi 48428687  530 FV 531
gi 75162463  568 SV 569
gi 74703169  562 AV 563
gi 74594083  440 AI 441
gi 121741408 462 AI 463
gi 48428684  521 FV 522
gi 75015581  447 FV 448
gi 121713924 468 AI 469
gi 551522418 612 FI 613
gi 145249824 465 GI 466
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap