NCBI CDD Logo
?
pfam13965: SID-1_RNA_chan 
dsRNA-gated channel SID-1
This is a family of proteins that are transmembrane dsRNA-gated channels. They passively transport dsRNA into cells and do not act as ATP-dependent pumps. They are required for systemic RNA interference.
Statistics
?
PSSM-Id: 258217
View PSSM: pfam13965
Aligned: 8 rows
Threshold Bit Score: 716.477
Threshold Setting Gi: 157954023
Created: 30-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:

pfam13965 is a member of the superfamily cl16505.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901077  184 SQP-QYfLYK-------FPE-DVDSVIIKVVSEKAYpCSVVSVQNIMCPVYDLDHNVE--FNGVYQSMTKKAAITLQKKD 252
gi 75022298  151 SEPvYL-RYD-------IPG-DVDSVAVHLDSNSTI-CMTVSVQKIGCPVFDLPDNVN--SMGLHQTMTTSATIPVEKSR 218
gi 41018137  197 VKPiGFfLNC-------SEQ-NISQFHVTLYSEDDI-CANLITVPANESIYDRSVISDktHNRRVLSFTKRADIFFTETE 267
gi 270009226 165 SEPrFYfYNFtanitesPNS-NYETVILEVFSDDFV-CMTVSIQNASCPVFDTNQDIT--FRGFYETVNTQGGITIPKYK 240
gi 145909858 173 SEPvYY-YYS-------FKQ-NSSMVLLHVKSDDSI-CMTLSIQNSSCPVFDSLETVQ--YDGLRQTVSKTGGIIISKDE 240
gi 268556782 195 VKPiGFfLDT-------EEQ-IVKSFHITLTSADDI-CANVITAPANESIYERPVDSDraDNRRVLTFTRRADIFFSETE 265
gi 157694508 175 SESkYYyYKF-------HDK-KNTSAMIEINSDDDV-CLTVSIQDSFCPVFDLDKDIT--YEGKYQTINRKGGMTIRQRE 243
gi 157954023 152 SEPrYFsYDY-------VPQsHSSLVTIEIDSDDET-CLMVSVQKHTCPVLDLNNFIN--YQGFHQTILTKGGMRIRKKY 221
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901077  253 FPd-eQFFVVFVIKPEDYACGGSFsiqenE------NQ-T----WNLQR----SKNLKVTI-VPSIKesvYVKSSLFSIF 315
gi 75022298  219 MS---SFYVVFVVNTNDDLCSEIL-----S------IK-P----NKPTKfplrMKSFNVTI-ESSMK---IFDYTIPIVF 275
gi 41018137  268 ISmfkSFRIFVFIAPDDSGCSTNT-----S------RK-S----FNEKK----KISFEFKK-LENQS---YAVPTALMMI 323
gi 270009226 241 FPy-gFFAVF-VAKPDDSDCTGIP-----S------LYyD----TNRTK----TITLIVKP---SIS---YQDYVNAVIA 293
gi 145909858 241 YPl-gLFIVFVV-HSDDSACHQGN-----Y------QA-I----NSRTK----SINFVVKP-TVDFN---YQIINCLIVI 294
gi 268556782 266 IQlfkTFRIFVFISPVNAPCSGNT-----S------RK-N----YNEIK----KITFDFTR-LEPNS---YFVPTLAMLV 321
gi 157694508 244 FPd-gFFLVF-VAKADNYQCSQKH-----SvllvehRK-QhlilANRTS----TITFTINKgINGKE---YEIASLATLG 308
gi 157954023 222 YTg-gFFLVFTVV--EDEVCKKKD-----L------PI-I----PNQNQ----SSTVHFTV-TENIE---SKNHYIPAVF 274
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901077  316 VFLSFYLgcL-LVV-LVHHVRFQRKSI--DgsfgssdgsgnmavSHPITASTPE-GSNYgaidesssspgRQMSSsdggQ 390
gi 75022298  276 WACILLL--V-TIVvFVYHYFDGIWER--Rf------------vSRAYTHLEDN-AQEQ-----------RIRDF----Y 322
gi 41018137  324 FLTTPCL--L-FLP-IVINIIKNSRKL--Ap------------sQSNLISFSPV-PSEQ-----------RDMDL----S 369
gi 270009226 294 TLSSIGI--FyFVF-IAGFIFCSKRGYvpR--------------QMEYVSSEPAtPSTC---------------L----G 337
gi 145909858 295 VIFIFIL--V-FTT-FFYHTKGD--DL--K--------------TIDIIQEEPS-TSICs----------TPVNI----Q 337
gi 268556782 322 FFASPCL--I-FIAsLTVNVIRNRSDL--V---------------ADLISFS---------------------------- 353
gi 157694508 309 ALLSFCI--V-STI-MIFAFTRWG----------------------TISKFRPS-GDEL-----------DADW------ 344
gi 157954023 275 IVLACFI--L-FSF-VAIAIFCVFERY--R--------------KKKIAK-----NTEQ-----------IAMNV----D 314
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901077  391 PCH-SDTDSSVEESDf-D--TMPDIESdkNVIRTKMFLYLSDLSRKDR--RIVSKKykIYFWNIITIAVFYALPVMQ-LV 463
gi 75022298  323 DFQrMSEDDDLKDYD--L--LTDCQDM--MVVRAKASLTVADLSMTPYeeRELKYD--VYKIALAIIGIFYNITVLQ-LI 393
gi 41018137  370 HDE-QQNTSSELENNgeI--PAAENQIveEITAENQETSVEEGNREIQvkIPLKQDslSLHGQMLQYPVAIILPVLMhTA 446
gi 270009226 338 EEV-DEISLDETEYD--Vv-SEADQDK--SIRLGKSVVYLSDLARKDP--RVHKYKsyLYLYNVLTVALFYGLPVIQ-LV 408
gi 145909858 338 PDN-VNYDSSLDETD--IdiLKSPEPWk-DLIRTKACLYVSDLSKKDH--RILKAKsrLYVWNLITVAVFYSLPVTQ-LV 410
gi 268556782 354 SDQ-SANTSAIAENN------MAHNEI--AVIPEEENLQVQEIE---P--IPIKQDslSLHGQMFKYPVALILPVLMhTG 419
gi 157694508 345 -EE-PPEPPITRELK--------------HELLSRQALTVNLLARAPE---KDKRRsyNYLWHILSIAIFYSIPVVQ-LV 404
gi 157954023 315 EKT-EEEIHEERDEN--------NQQI---------PNNVADFSQNTQ---KNQKRsmNYLWQILNVGLFYIIPVIQ-LV 372
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901077  464 ITyqTVVNV--T--GNQDICYYNFLCAHPL----GVLSAFNNILSNLGHVLLGFLFLLIVLRRDLLHRRaleakdifAME 535
gi 75022298  394 IS--KAGSLrqS--GDLDECTFNFQCARPL----WYFVAFNNVVSNGGYVYFGTLIIVMNYCRERSFRRlfavqptlAER 465
gi 41018137  447 IEfhKWTTStmA--NRDEMCFHNHACARPL----GELRAWNNIITNIGYTLYGAIFIVLSICRRGRHEY--------SHV 512
gi 270009226 409 VTyqRVLNE--T--GQQDLCYYNFLCAHPL----GVISDFNHVFSNSGYVLLGLLFLGITYRREITHKDln-----fERQ 475
gi 145909858 411 FTsqKMLIE--T--GNQDLCYYNFLCSHSFilgpWKFSDFNHIFSNIGYIFFGLLFILITYKRECVNIP--------NKK 478
gi 268556782 420 VEfhNFTTS--TmaNRDEMCFHNNACAKPL----GELRSWNNMISNIGYAIYGLVFIMVTMCRRWRH-H--------SPL 484
gi 157694508 405 ITyqRVVNR--T--GDQDMCYYNFLCANPA----FGLSDFNHIFSNVGYIIVGILFLGVVLHRQTK-IP--------NSS 467
gi 157954023 373 VTlqSFLIQ--T--GDFDLCYYNFRCANPL----WIISDFNHVFSNIGYILMGIVFSINVFYRHFYS-P--------PLT 435
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901077  536 YGIPKHFGLFYAMGIALMMEGVLSACYHVCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINASAYSAYASFAVvITLT 615
gi 75022298  466 YGLPQHSGLMTAIGLAVIMEGISSATYHVCPNNINYQFDTALMYVIGMLGKLKIWSLRHPDMVVSAYHAFGFLGV-FLMA 544
gi 41018137  513 FGTYECTLLDVTIGVFMVLQSIASATYHICPSDVAFQFDTPCIQVICGLLMVRQWFVRHESP-SPAYTNILLVGV-VSLN 590
gi 270009226 476 YGIPQHYGMFYAMGVALIMEGVLSGSYHVCPNTANFQFDSSFMYVMAVLCMVKLYQNRHPDINATAYATFGVLAV-AILL 554
gi 145909858 479 FGIPNHYGLYYAMGSALAMEGLMSACYHVCPNHSNFQFDTSFMYVICMLSMIKIYQTRHPDINANAYLVFGVLAL-VIIL 557
gi 268556782 485 VGTYECTLLDITIGLFMILQAIASATYHICPSDIAFQFDTPCIQVICGLLIIRQWLVRQESP-SPAYTNILLFCV-VSLN 562
gi 157694508 468 TGIPVHYGVYYAMGIALIIEGILSACYHICPSQSNYQFDTSFMYVMAVLCMIKLYQNRHPDVNATAYATFTVLGM-AIFL 546
gi 157954023 436 TGVPANYGVFYAMGAALIMEGVLSGCYHLCPNETNFQFDTSFMYVMIVLCLVKLYQNRHPDVTPTAYTTFSILGA-TILC 514
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901077  616 VLGVVFGKNDvWFWIIFSAIHILSSLALST---------------QIYYMGRFKI------------------------- 655
gi 75022298  545 AIAGVYVHNM-IFWALFSIIYIASMLLVSL---------------EFYFKGIWTLnlrelrnsirlsw--vssrhlscvv 606
gi 41018137  591 FLISAFSKTS-YVRFIIAVIHVIVVGSICLa--------------KERSLGSEKL------------------------- 630
gi 270009226 555 GMIGILEGNL-YFWIVFTIIYLLSCFYLSI---------------QIYYMGCWKLdaglamrvwricvyefwsgplnvik 618
gi 145909858 558 GLTGIMYEGP-ILFVLFTCLHLIMIFWLSa---------------QIYYMGRWKLdkktpkrflnhi-----mtapnpcr 616
gi 268556782 563 FLISACSKAS-GIRYLIAIIHFGVVATVCLa--------------KRKTLRSKQV------------------------- 602
gi 157694508 547 AMIGILNGSL-TVWIVFVVIYSLLCAYISFkiyfisfvfdgfkqlKQSLKSSNKVeaia--------------------- 604
gi 157954023 515 GTIGIVFKAP-PVFIVFVTIAYLVLLIYASl--------------NIYHFGTARN------------------------- 554
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901077  656 ---DLGIFR-R-AamvfytdciqqcsrplymdrmvllivG-NLVN----WSFAFFGLIYR---PRDFASYMLGIFICNLL 722
gi 75022298  607 payKARFFViL-L--------------------------L-NIAN----TAVVVYGLEAH---PKDFLSFLLIPFIGNLF 651
gi 41018137  631 ---KTRFFI-M-A--------------------------F-SMGN----FAAIVMYLTLS---AFHLNQIATYCFIINCI 671
gi 270009226 619 pihKARMCL-L-Ii-------------------------A-NLCN----WGMAFWGVYKH---QKDFALFLLAIFMGNTL 663
gi 145909858 617 pkyPNRMVL-L-S--------------------------FgILIN----LGLAVSHWMIK---FGNFGNYLLILFMVNLI 661
gi 268556782 603 ----YKVFV-G-T--------------------------F-AIFN----FFAITIYVTSS---YIHLNQISTYCFILNCI 642
gi 157694508 605 pirKSRFAL-LvI--------------------------A-NIIN----YAMLITGLCLYntgVTDFGTFLLGLLMGNSV 652
gi 157954023 555 ---FLRRCC-L-Rnsevprpiqsp-----nthrwwllllA-ITVNillyGLGLILFYHTK---TIDFATFILQILAGNAF 620
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901077  723 LYLAFYIIMKL--------RSSEKVLPLPVFCIAATAVVWAAALYFFFQNLSSWEGTPAESREKNRECVLLDFFDDHDIW 794
gi 75022298  652 IYIIYYILMKM--------IYREKIPKRAIALLFAAVISWTCAGILFNQRVSDWSKMPAISRELNKPCIFLNFYDNHDLW 723
gi 41018137  672 MYLMYYGCMKV--------LHSERITSKAKLCGALSLLAWAVAGFFFFQDDTDWTRSAAASRALNKPCLLLGFFGSHDLW 743
gi 270009226 664 LYFSFYIVMKI--------INKERVNKLSLFFLSLSVLCAISAMYFFLNKSISWSRTPAQSRQFNQECKLLRFYDFHDIW 735
gi 145909858 662 LYLSFHIVMKL--------ISKEKLHFWPLLYILLAMIFWSASLYFYVHKSSSWTLSAAESRTYNTPCTFMDFYDNHDIW 733
gi 268556782 643 LYLTYYALMKF--------ASRESIELKAKVCGVSAIFGWLIAGFFFFQDDTDWTRTAAMSRALNTPCLLLDFFGSHDLW 714
gi 157694508 653 LYAVFYTGMKL--------VNGERICFEAIIYGLLAIAAWATAAVYFLDNATLWTVTPAESRQWNQECIVMSFYDKHDVW 724
gi 157954023 621 LYTVVYTCMKIkctsvrecTCSEKICAQAIIYGFLALVTWVLAGVFFFTEASKWTESPAQSRQLNKQCIFADFYDSRDLW 700
                        730       740       750
                 ....*....|....*....|....*....|...
gi 62901077  795 HFLSATALFFSFLVLLTLDDDLDVVRRDQIPVF 827
gi 75022298  724 HLSSAFAIFFSFTAINVIDDDLMFVMRNTIRVF 756
gi 41018137  744 HIFGALAGLFTFIFVSFVDDDLINTRKTSINIF 776
gi 270009226 736 HFLSAIGMFFTFMVLLTLDDDLSHTHRNKIVVF 768
gi 145909858 734 HFLSAISLFLSFMVLFTLDDDVNSKPTATIPVF 766
gi 268556782 715 HMFGAIAGLFTFLFVSFVDDDLINTPKSSINMY 747
gi 157694508 725 HLLSAPALYLTFMFLLSLDDDLVDIKREEITVF 757
gi 157954023 701 HFFSSLALYFTFMYLLCIDDNLYTN-RADIPLF 732
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap