NCBI CDD Logo
?
pfam13890: Rab3-GTPase_cat 
Rab3 GTPase-activating protein catalytic subunit
This family is the probable catalytic subunit of the GTPase activating protein that has specificity for Rab3 subfamily (RAB3A, RAB3B, RAB3C and RAB3D). It is likely to convert active Rab3-GTP to the inactive form Rab3-GDP. Rab3 proteins are involved in regulated exocytosis of neurotransmitters and hormones. The Rab3 GTPase-activating complex is a heterodimer composed of RAB3GAP and RAB3-GAP150. This complex interacts with DMXL2.
Statistics
?
PSSM-Id: 258157
View PSSM: pfam13890
Aligned: 27 rows
Threshold Bit Score: 178.294
Threshold Setting Gi: 154338664
Created: 31-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:

pfam13890 is a member of the superfamily cl16458.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121956145  459 HAPWN----QPVGRLSK----LG-KMLLVD-SDEPLYIPITQEPVPKTEDQLEDDAEVMLKLGP-----GSELC------ 517
gi 75171517   316 AKSNSgeliLRLGVYNQ----VE-NLTMLE-TGEPVYSPITQEGPLLTEDLIRETEELVLRTGSmg--aGC--------- 378
gi 74831378   605 DVIHRsndsEFYGRCTK----RV-K-RLIT-NGEVLVEPQPLPVPPYTTDILLAKSQEERDPHShsassSQHSP------ 671
gi 122044960  596 ASHSRgeasAADGECSAdgflIS-GKCLIT-NGEPLVEPKALPTPPCTSDVMMMKAQELQNLGTes--aGRHTR------ 665
gi 170589569  600 ISKEEsdssGAEGRLKP----FG-TLRLIHyPDRLMYEPVTQTRVPVTEDMLEKHAEYLASLKDpe------eR------ 662
gi 301096997  477 PSPSRat-rLPEGVVRE----VP-GVVCLQ-TNEPLLEPVTQSAVPMTEDVAKQQQDLLTRLGVsv--eSDKLR------ 541
gi 168025179  431 AKLKTgekvLRIGADRP----AA-DLLMLE-TGEPVYSPITQDNPIMTEDAIRETEELILRTRSvg--aGC--------- 493
gi 115472321  326 IKGSAgdnvLRLGADHP----SE-NLTLLE-TGELVYSPTLQEGPIMTAELIKETEELVLRTGSvg--aGC--------- 388
gi 219125909  905 GSIDHtqvrERKGARCP----MK-NINLLE-TGDQLYAPYLQRPYPLTDDVITQRRMMLLKQKSsg--kASSTV------ 970
gi 224007018 1825 AKVKRghnhNRVGARCP----VPdVLPLIE-TGDQLYAPYLQRTMPVTDEEEEKQKKLLGVSRKde--dEKRVSiqsria 1897
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121956145  518 --TQ-------MMSASLLSDMESF-----------------KAANPA-----GKLEDFIRWY-SPRDWIE------ED-T 558
gi 75171517   379 --------------SQLLSDMQAFkviilmnnlitvwyistHAANPG-----CILEDFVRWH-SPPDWTE------NGnM 432
gi 74831378   672 --SL-------VLNEGLFNDMCLF-----------------LYVNRShegrvVRFADFVHWY-SPRDFVS------PPhS 718
gi 122044960  666 --AW-------IQSEGLFNDMCLF-----------------LYFNRAqegrvVRFPDFVQWH-SPRDFIP------Pl-C 711
gi 170589569  663 --VK-------AQLEPLFSDMEAF-----------------KAANPG-----CCFEDFVRWH-SPRDFIv---------N 701
gi 301096997  542 --QQ-------IQSTTLISDMQAF-----------------KAANPR-----CCLTDFIRWY-SPKDWIPfktridPEtT 589
gi 168025179  494 --------------SQLLSDMQAF-----------------KAANPG-----CILEDFVRWY-SPLDWRE------EPgS 530
gi 115472321  389 --------------SQLLSDMQAF-----------------KAANPG-----CVLEDFIRWH-SPPDWSE------DCaA 425
gi 219125909  971 --LRrmevahlLQKPKLLSDMQAF-----------------KAANPN-----AIFQDFVNWYgNPRDPLE------EYeE 1020
gi 224007018 1898 isQR-------LQKPKLLSDMSSF-----------------KAANQG-----AVFEDFVRWYgNPQNPLS------EEvN 1942
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121956145  559 D---------E---RD-P--------------FGRKGH---------------LSSR------MMI---PG-------NT 580
gi 75171517   433 S---------G---DD-S--------------SPVRGQ---------------LSTR------MQK---EG-------NL 454
gi 74831378   719 P---------A---TG-TtetggptkpdfevdINDSAY---------------LSER------MQRr--ED-------NT 755
gi 122044960  712 D---------S---KEkK--------------DDDDAY---------------LSER------MRR---HSnaenglvNI 741
gi 170589569  702 D---------E---NT-G-----------------EGC---------------LSSR------MTG---EG-------NT 720
gi 301096997  590 Dl-------pQ---QG-Rgv----------wwFESHGM---------------LSER------MRFgpgHE-------HI 620
gi 168025179  531 GlmfqgssenA---GE-N--------------GAVRGY---------------LSAR------MQC---QG-------NL 561
gi 115472321  426 S---------SaevGE-G--------------SSRRGR---------------LSER------MQTk--EG-------NL 451
gi 219125909 1021 Slsl---alrP---GT-S--------------DTIETK---------------LDKAkegiyvLSM---TR-------DF 1054
gi 224007018 1943 G---------E---TA-R--------------RAAQYRsklppeeakvlaleeASEA------IAIlmsLR-------AF 1982
                         250       260       270
                  ....*....|....*....|....*....|....*.
gi 121956145  581 WQTVWDDARPVPARR-QRRLFDDAKEAEKVLHYFDS 615
gi 75171517   455 WRELWETAKPLPAVK-QAPLFDEDLAVEGILNYLED 489
gi 74831378   756 WWLLWEQAAPRSPEEiIEQLFVPEEQAHDVVNWMES 791
gi 122044960  742 WWPLWERATPRSPEEiIAQSFVPHEQARLIIRWMEK 777
gi 170589569  721 WQQTWNRAQLKPAYR-QKLLFDDLKAANKIISDFEN 755
gi 301096997  621 WQQMWDTSVPMPASR-QKPLFDPVQESEKVYHYMET 655
gi 168025179  562 WQELWASSRPVPALK-QSPLFDEELAGESTLDVLEA 596
gi 115472321  452 WKELWGAAKPIPAVE-QAPIYDEDLAVESIFDALEv 486
gi 219125909 1055 WTGTWKEAKPLSASF-QEPLFDATMTVEMMLDFLET 1089
gi 224007018 1983 WEDSWDEAEPCPAFE-QEPLFDPYSTVEMVFHSFET 2017
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap