Conserved Protein Domain Family
Tropomyosin_1

?
pfam12718: Tropomyosin_1 
Click on image for an interactive view with Cn3D
Tropomyosin like
This family is a set of eukaryotic tropomyosins. Within the yeast Tmp1 and Tmp2, biochemical and sequence analyses indicate that Tpm2p spans four actin monomers along a filament, whereas Tpmlp spans five. Despite its shorter length, Tpm2p can compete with Tpm1p for binding to F-actin. Over-expression of Tpm2p in vivo alters the axial budding of haploids to a bipolar pattern, and this can be partially suppressed by co-over-expression of Tpm1p. This suggests distinct functions for the two tropomyosins, and indicates that the ratio between them is important for correct morphogenesis. The family also contains higher eukaryote Tmp3 members.
Statistics
?
PSSM-Id: 257245
View PSSM: pfam12718
Aligned: 42 rows
Threshold Bit Score: 78.0212
Threshold Setting Gi: 401205
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam12718 is a member of the superfamily cl22857.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2TMA_A         7 KMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAE---- 82
gi 29337029    7 KMMAMKLEKENALEKAINLENQLKEKAKDFEKKEEEMNDWLSKVKNIQTEVDTVQESLQEAISKLEETEKRATNAEaeva 86
gi 40548507    4 KMQAMKLDKENACDRADIAEQQSRDANARADKAEEEVRSLQKKIQQIENELDQVQEQLVTANAKLEEKDKALQNAEgeva 83
gi 40548517    7 KMQAMKLEKDNAMDRADTLEQQNKEANNRAEKAEDEVNKLQKKMQQLENDLDQVQESLLTANNQLEEKDKALSNAEgeva 86
gi 118638264   7 KMQAMKIDKDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQVQESLTQATTKLEEKEKALQTAEgdva 86
gi 40548511    7 KMQAMKLDKDNACDRADTAEQQCKEAELRAERAEEEVRTLQKKIQQIENELDQAQEGLLQANNNLDEKDKALQTAEgeva 86
gi 56754104    7 KMIAMKLEKENAMERAVQYEELLKKKEEEREKRENEISELNTKMKQAQIDCDEVQETLQEQMNKLEETEKRATNAE---- 82
gi 122118417   7 KMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQTQEALMAVNAKLEEKEKALQNAEseva 86
gi 225711890   7 KMQSLKSETDALYATINKFETETKEANARSDQFECDIRDLGKKSQSYEVEFDETNDKLTKALESLEEKEKAFKNAEeevg 86
gi 154466686   7 KMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKAQEDLSVANSNLEEKEKKVQEAEaeva 86
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
2TMA_A        83 AdvasLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKH 153
gi 29337029   87 A----MTRRIRLLEEDFEQSSGRLTETSTKLDDASKAAEESERNRKTLETRSISDDERMAQLEEQVKEAKY 153
gi 40548507   84 A----LNRRVQLLEEDLERSEERLKIATQKLEEATQLADESERMRKMLEHRSITDEERMDSLDGQLKEARM 150
gi 40548517   87 A----LNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERMDALEDQLKEARF 153
gi 118638264  87 A----LNRRIQLIEEDLERSEERLKVATAKLEEASQAADESERMRKMLEHRSITDEERMEGLENQLKEARM 153
gi 40548511   87 A----LNRRIQLIEDDLERSETRLVSATEKLAEASQAADESERMRKMLEHRSITDEERMDGLENQLKEARg 153
gi 56754104   83 AevaaMTRRIRLLEEDLEVSSSRLTETLTKLEEASKTAEESERGRKDLEIRSIADDERLNQLEDQQKEAKY 153
gi 122118417  87 A----LNRRIQLLEEDLERSEERLASATAKLSEASAAADESERARKVLENRALADEERMDALENQLKEARF 153
gi 225711890  87 A----LSRRIMLMEEEAKKAETTLADTVTKLAYASKEADGILKKVKYFENKTMRNEVELEEGDKNLRETTK 153
gi 154466686  87 A----LNRRMTLLEEELERAEERLKLATEKLEEATHTADESERVRKVMENRSFQDEERANTVESQLKEVQM 153
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D