NCBI CDD Logo
?
pfam10487: Nup188 
Nucleoporin subcomplex protein binding to Pom34
This is one of the many peptides that make up the nucleoporin complex (NPC), and is found across eukaryotes. The Nup188 subcomplex (Nic96p-Nup188p-Nup192p-Pom152p) is one of at least six that make up the NPC, and as such is symmetrically localized on both faces of the NPC at the nuclear end, being integrally bound to the C-terminus of Pom34p.
Statistics
?
PSSM-Id: 256020
View PSSM: pfam10487
Aligned: 4 rows
Threshold Bit Score: 1077.98
Threshold Setting Gi: 1709216
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:

pfam10487 is a member of the superfamily cl11127.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74609285   26 EHINAVSAFLEKNKRQLLE-LQLGSNESTKHNDNNDTKRIIARkILGY---DYDFEGSNEYnLNEFLEKELLERNSMV-D 100
gi 1709216    35 KQLAQIRQFLKANKTNLIEsLNTIRQNVTSSGDHNKLRSTIAN-LLQInvdNDPFFAQSED-LSHAVEFFMSERSSRL-H 111
gi 82075210   25 REPAQIASELNKHWQRLLEgLSYYKPPSTTSAEKIKADKDVAApLKELglrVSKFLGLDEEqSV-LLQCYLQEDYRGTrD 103
gi 74587965   46 YLADALDEFLLSSKEVLLN-PSPFTLKNDKQSPNSQTRDISLRgILYTnisAQD--TSDGKlLSNLLNLDVLETIRVIcQ 122
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74609285  101 IMVDL--NTRRHIcdryipDLNVNNAKNEDSLt----GRIST---VIDVLLNTLTATNSVDECVLQCMDHLE-ELHldne 170
gi 1709216   112 IVYSL--LVNPDI------DLETYSFIDNDRF-----NVVGK---LISIISSVIQNYDIITASSLAHDYNNDqDMF---- 171
gi 82075210  104 SLKTV--LQDERQsqa--lmLKLADYYYEERIc-----ILRC---VLHLLTYFQDERHPYTAQYFQCVEKLDkELVpnyr 171
gi 74587965  123 TNKKIpcKTAPPQleaiksKLHDEKYYENKRLrlyssKILRErriILKIVTELLNNKS--NSYASSSIQNLGkEIFls-k 199
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74609285  171 dTIQDII------------------------DLIINYNILYCFKLLK-LLTLYIINRNVAVSLTQKWFSNF-SEIVNQVT 224
gi 1709216   172 -TIVSLV------------------------QLKKFSDLKFILQILQ-ILNLMILNTKVPVDIVNQWFLQYqNQFVEFCR 225
gi 82075210  172 kQFEELYkaeaptwe---------thgnlmtERQVSRWFVQCLREQSmLLEVIFLYYA--------YFEMApDELLAFAK 234
gi 74587965  200 qYLESLIesigkasqslmkrsyitginkeidETIHNETVLFCIEACKvLIELSVQNANVDAQAVHSWF-----------K 268
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74609285  225 LISSTHSN--------RRFLDNTERSMVDTLFIAKLESTISIVSIVFLGLSSARedSNLNMDT--DFLHDVATFELVHSV 294
gi 1709216   226 NINSTDKSidtsslqlYKFQNFQDLSYLSETLISRISSLFTITTILILGLNTSI--AQFDIQS--PLYMDTETFDTVNSA 301
gi 82075210  235 LFKEQGFG--------TRQTNRHLVDESMDHLVDRIGYFSALILVEGMEIDSLHerALDDRTEehKLANNSHIHQEMDNQ 306
gi 74587965  269 LMRDTNYSva-----lGPYVSYHEA-------FSILQGLFTVLTIQYLNLNNSFdsVNETSSS--SYMADVQVFKYVNDA 334
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74609285  295 LLD--EMHKKr-------mPIVLYMWSFILCAKSIIAEDDSdeitsineldfirkcFPQDSihsmSILFAKNAEDIGLLA 365
gi 1709216   302 LEN--DVATNivnedpifhPMIHYSWSFILYYRRALQSSES---------------FDDSD----ITKFALFAESHDVLQ 360
gi 82075210  307 LLQlgDVSHH---------APVLLAWALLRHT------------------------INPEEsanvIRRMGSTAIQLNVFQ 353
gi 74587965  335 IAN--TANNN---------SVVLYSWSIILLRKFYFLQEYPelpnse----kflsqFNLSQlehtINLVNQKCDNLDVFS 399
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74609285  366 KFLETSNCIRND----NIFTTLFASFMTLSVNFIPFTASTTKIIKSVLNDLPRGVIENFISNNAFITK--------FDTI 433
gi 1709216   361 KLNTLSEILSFD----PVYTTVITVFLEFSLNFIPITASTSRVFAKIISKAPEQFIENFLTNDTFEKK--------LSII 428
gi 82075210  354 YLTKLLKSLSSGgkncTASTACMCIYGLLSFVLTSLELHTLGNQQDIIDAACEVLAASSIPQLFWKTEptaglgiiLDSV 433
gi 74587965  400 SLKKLNELLKFD----KLYSAILSTLIIASLPLITLTSEVTSCILSVIGNCPNNVIESFFENNATQNA--------IIIA 467
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74609285  434 KAKLPLIdegLLPFINL--TSINEELAEFNWEAFGSY--AVKMPLGSIDYDVADRSNSNDSSTl-----EQIQLSSEVLV 504
gi 1709216   429 KAKLPLLnesLIPLINL--ALIDTEFANFELKDICSFa-VTKSSLNDLDYDLIADTITNSSSSsdiivpDLIELKSDLLV 505
gi 82075210  434 CGMFPHL---LTPLLQLlqALVSDKSTA---KKVYSF--LDKMSFYIELYKHKPPDVISHEDG------TLWRRQAPKLL 499
gi 74587965  468 RTKFPLI---LSPYIQV--ASINGNFALHEFNDLKSYiqVFKKEEFNNMYQ------IDDQNT------ELVKTTKFIDV 530
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74609285  505 KPP-FEQDD-DVLMPLPKSTKAFIVAdvpaitsgkehtkdsivkynsedGSSNFTTnnvtnetLLVFDYQYNGWSLLGRI 582
gi 1709216   506 APP-LENENsNCLLSIPKSTKGKILTikqqqq-----------qqqqqnGQQPPTTs-----nLIIFLYKFNGWSLVGRI 568
gi 82075210  500 YPLgLGQTN----LRIPQGTVGQVML-----------------------DDRAY---------LVRWEYSYSSWTLFTCE 543
gi 74587965  531 YPP-FEANK-KLSMVLSLGTKAKILP-----------------------SANPDEV-------LVTFLYNYNGWAFLGRV 578
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74609285  583 LQNLSILYtvkgNDINYEQK-EFMIAAISLLSNIMSSTIPVDHSIKILESLSSQLSKPrd----dDIISVVFKIFER--A 655
gi 1709216   569 LQNLLHSYmekgTQLDDLQH-ELMISIIKLVTNVVDPKTSIEKSSEILSYLSNSLDTSastingaSIIQVIFEIFEI--S 645
gi 82075210  544 IEMLLHVV----STADVIQHcQRVKPIIDLVHKVISTDVSVADCLL-------------------PITSRIYMLLQRltT 600
gi 74587965  579 LQNVSKIF----NNSDSETM-ELVINILNSLNNVV-IDNGVDDSKMVLEAMSAYTDDS-------DILEVILRLLEQ--G 643
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74609285  656 LHKRNYELLCICASFTNVLVRRFPHFVWAYLSTSDLL----------------DHYGKSGLVNIILGSIELTNGEYDFTI 719
gi 1709216   646 LQRKDYTSIVQCCEFMTMLTPNYLHLVSSYLNKSDLL----------------DKYGKTGLSNMILGSVELSTGDYTFTI 709
gi 82075210  601 VISPPMDVIASCVNCLTVLAARMPAKVWTDLHHTGFLpfvanpvssmnhmisaEGMNAGGYGNLLM-SIEQPQGEYSVTI 679
gi 74587965  644 LHLRNVKLLVSVVNLLTNLMPFLSYRIWPYLSKSALF----------------AQNGKEGLAAVIFGSIEMVNGDYNFTV 707
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74609285  720 SIAKMTVGLIDDAVTtslySDSGVPLKTKKSILSNLIVHLLNVYESFQFWKYSKSIeQRFELSLELTKAFSKILYFVHGI 799
gi 1709216   710 QLLKLTKVFIRESLSl---KNIHISKRSKIDIINKLILHAIHIFESYYNWKYNNFL-QKFEIAFHLTLIFYDVLHDVFTI 785
gi 82075210  680 SFLNLITTLVRGQLG----------STQSQGLVPCIVFVLKEMLPNYHKWRYNSHG-VREKIGCLILQLIHAILNLCPEM 748
gi 74587965  708 SLIKLAEALIQNCLS----LDQDYPEKSKSVIMLRFVGHLVDLFETFLYCRYNEQC-QKLEIGVLLLDTFSTILASVYGI 782
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74609285  800 DsetpPENKITNV------LSKAADTITNAFLVPDSYDPPVVISLINTITS-PKNKTIYIFGNGlFDELYDHVVQKAYDL 872
gi 1709216   786 N----PHQKDQLI------ISSSANKLLQLFLTPMDSIDLAPNTLTNILIS-PLNTTTKILGDKiLGNLYSKVMNNSFKL 854
gi 82075210  749 DprssNAPSLQSLcifslaNTEAGQAVINIMGIGVDTIDMVMA---------SQSSSDESQGQG---QLLIQTVKLAFSV 816
gi 74587965  783 DegvpANTKVTKV------FADAASRILDSFLISDEDSPRAARSIITMIENlSQDLDLYELTDS-SSFWYDNWIHCALSF 855
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74609285  873 ANLLVSIRGVSK-LNASSLERMLF---CQSPKLIDIYlTK------PT---LKISIVKLLNSLVGVPWSSEY-PFLYSYL 938
gi 1709216   855 CTLLIAIRGSNRdLKPSNLEKLLF---INSSKLVDVY-TL------PSyvhFKVQIIELLSYLVEAPWNDDY-PFLLSFL 923
gi 82075210  817 TNNVIRLKPPSSvVSP--LEQALTqhgAHGNNLIAVLaKYiyhkhdPAlprLAIQLLKRLATVAP--------MSVYACL 886
gi 74587965  856 SRLIITIRTSEH-LKPSAFEKSLF---TKTPDLVLSYsRF------ES---VRKDILDLLTALTSGDWPDGTaPSLLSHL 922
                       1050      1060      1070      1080      1090
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 74609285  939 GHTYSEKFLSSIIKDLTTTLQDYQLAKTLYVFFGTLIRSKQDGLSILFLTGRAPDK 994
gi 1709216   924 GEAKSMAFLKEVLSDLSSPVQDWNLLRSLYIFFTTLLESKQDGLSILFLTGQFASN 979
gi 82075210  887 GSD-AAAIRDAFLTRLQSKIEDMRIKVMILEFLTVAVETQP-GLIELFLNLEVKDG 940
gi 74587965  923 GSENAQVLLHSLAADLDNSFDDYKMKISLYDFICAVMEGKQEGLAVLFITGRDVFG 978
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap