Conserved Protein Domain Family
PI3K_1B_p101

?
pfam10486: PI3K_1B_p101 
Phosphoinositide 3-kinase gamma adapter protein p101 subunit
Class I PI3Ks are dual-specific lipid and protein kinases involved in numerous intracellular signaling pathways. Class IB PI3K, p110gamma, is mainly activated by seven-transmembrane G-protein-coupled receptors (GPCRs), through its regulatory subunit p101 and G-protein beta-gamma subunits.
Statistics
?
PSSM-Id: 256019
View PSSM: pfam10486
Aligned: 4 rows
Threshold Bit Score: 992.573
Threshold Setting Gi: 74746772
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam10486 is a member of the superfamily cl11126.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74716480   6 TTCTEDRIQHALERCLHGLSLSR-RSTSWSAGLCLNCWSLQELVSRDPGHFLILLEQILQKTREVQEKGTYDLLTPLALL 84
gi 82081081   4 TTCTEDRIYHALERCLHGLSRDA-VSSRWAAGLCLNCWSLQELVSRDAGNYLILVEKILGKAREVQEKCDYDLVMPLALL 82
gi 83288385   4 TSCTEDRIQHALERCLHGLSGSTdISSNWTAGLCLNYWSLEELVNRDATNYIILAEKTLARTREAQKNGEYELLTPLALM 83
gi 74746772   3 SSDVELDLQRSVQAVLRELSTQA-PALQSNQGMWR--WSLHKKVERDPGKSPVLVRILLRELEKAESQDLRHVIIPLLHT 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74716480  85 FYSTVLCTPHFPPDSDLLLKAASTYHRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSSTVTVL 164
gi 82081081  83 FYYAVLYAPHIPPDSELLLKAASIYHSFLTWPVPYCDVFRELLTFISDELKAPGISFQRLVRTEQGLPVKNYQSSTVTVL 162
gi 83288385  84 FYFAVLRAPYIPETSDLLPKAFEVFHTFLTWPAPYCHVYQEMLSFISEEQKAPGITYQRLVRTEQGIPTRSSCSSTATVL 163
gi 74746772  80 VMYVLTKATGI--TEELYQRIYAFCTRLLTLPTPYCTVALDCAIRLKTEMAVPGTLYQRMVIAEQNLTNELYPYQERVFL 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74716480 165 LLNPVEVQAEFLA---VANKLSTPGHSPHSAYTTLLLHAFQATFGAHCDVPGLHCRLQAKTLAELEDIFTETAEAQELAS 241
gi 82081081 163 LLNRSEVQSEFLS---IAEKLSSTEPPRHATLVLLLEHLYQVTFGTRCDLGSLHHLLKAKTLEELSEIYTSAAEAQEIAA 239
gi 83288385 164 LVNPAELPSEFLS---VAEQLSNAEQPIQQTLVSLIQHLFQASLGTHAHTEELGASLKSRPIEKLQEIYSDLTEAMEHAT 240
gi 74746772 158 FVDPELVSASVCSallLEIEAAQAQQTPETCMRHVVSHALQAALGEACHAGALHRKLQASPRRTLEHYFHAVVAALEQMA 237
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74716480 242 GIG-DAAEARRWLRTKLQAV-----GEKAGF-PGVLDTAKPGKLHTIPIPVARCYTYSWSQDSFDILQEILLKEQEL--L 312
gi 82081081 240 ASS-DPVLARERLQSALRDI-----AGAAAL-PTIAGDAQPRRLQPIPIPTSRCYTYSWDQDNFDVLNDVLSKECSV--V 310
gi 83288385 241 MADiKPGKKRESLKAKLLEV-----AEKAGLmQGNTGSSLTSRIQPIFMPVAKCYTYSWDQDDFDILNQILLSESHLesL 315
gi 74746772 238 S---EASPSREGHVERLEEIycsllGPAAGRcGGDLVQERPPSI-PLPSPYITFHLWTGEEQLWKELVLFLRPRSQL--- 310
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74716480 313 QPgILGDDEEEEEEEeevEEDLETDGHCAERDSLLSTSSLASHDST-----------------LSLASSQASGPALSRHL 375
gi 82081081 311 EP-VASENEEDEEEE---EEDVETDGCSPERDSLLSPISSISKDSVysalsedgpkhscvslfSSSKDSISELTVVSKKS 386
gi 83288385 316 EDdVTEEDEEVDFEEv--DDKDEDGGKSPKQDSVFSNSYVYWNFPS-----------------DSKEDPSMSMSNLASHS 376
gi 74746772 311 ---RLSADLEVLDLQ----------GLRPDRE-------------------------------------------LAR-- 332
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74716480 376 LTsFVSGLSDGMDSGYVEDSEESSSEWPWRRGSQERRGHRRPGQkf-iRIYKLFKSTSQLVLRRDsrsLEGSSD------ 448
gi 82081081 387 LRsFVSSLKDCMDSGYAEDSDESSLDTLGRPELKVEKTHHKYRHtltnKIYKLFKSKSQLVLRRD---LKDCVDt----- 458
gi 83288385 377 MT-FVSSLSSCVDSGYVEDSDEGSQEISEIGEYQEERANNKLKQ----KICQLFKTKGHQAKDKLkaeLSPCIShpllsp 451
gi 74746772 333 ----VSVLST--DSGIERDLPTGADELPAPGSPEMERAG--------------LQRKGGIKKRa---------------- 376
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74716480 449 -----TALPLRRAGSLCSPLDEpvSPPSRAQRSRSLPQPKLGTQLPSwLLAPASRPQRRRPFLSGDED-----PKASTLR 518
gi 82081081 459 -----GSLPLRRAESLCHPQAKp-RIPARSRRAHSLPQHGLGQKLQT-PQTPQLLSLPRRPFLSYDED-----AKVATMR 526
gi 83288385 452 fpdisKTIPLRRAGSMYTPQLS--RIPVRSKRSKSLPQPAFGTQFLD-LQLSQKVAFKRRPFLSCDDD-----TKVSTLR 523
gi 74746772 377 -----WPLDFLMPGSWDGP-------PGLHRRT-------------------------GRP--SGDGEmlpgvSRLHTAR 417
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74716480 519 VVVFGSDRISGKVARAYSNLRRLENNRPLLTRFFKLQFFYVPVKRS--HGTSPGACPPprsqtPSPPTDSPRHASPGElg 596
gi 82081081 527 VVVFGSDRISGKVARAYSNLRLKESTCPTLTRYFKLQFFYVPVKRSclLPAALLMHPP-----PSPSDLQLRALAQAEpt 601
gi 83288385 524 IVVFGSDRISGKVARAYSNLRLKESSCPLLTRFFKLQFYYIPVKRSssSTNAPMTNAEsplksPSPSGRFPLQDVFGD-- 601
gi 74746772 418 VLVLGDDRMLGRLAQAYHRLRKRETQKFCLTPRLSLQLYYIPV-----------LAPEkpaasRQP-------------- 472
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74716480 597 ttpwEESTNDISHYLGMLDPWYERNVLGLMHLPPEVLCqQSLKAEAQ---ALEGSPTQLPILADMLLYYCRFAARPVLLQ 673
gi 82081081 602 lagaESSTNDISHYIGMLDPWYERNVLGLMNLPMDVLC-QSAKPEAE---PQEDSREQLPILADMILYYCRFATRPVLLQ 677
gi 83288385 602 ----EASTNDISHYIGILDPWYKRNIMGLMDLSTSMLC-QSSKEENE---TTE--TTTMPILADMVLYYCRFATRSLLLQ 671
gi 74746772 473 ------ELGELATFLGRVDPWYQSNV--------NTLC-PAIHKLAEmppSLDTSRTVDPFILDVITYYIRMGTQPIYFQ 537
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74716480 674 VYQTELTF--ITGEKTTEIFIHSLEL----------GHSAATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKGAISGR 741
gi 82081081 678 LYQTELTF--IGGEKMTEVFIHSLEL----------GHSAATRAIKASGPGSKRLGIDGDREAIPLTLQIAYSKTAISGR 745
gi 83288385 672 LYRAEITF--DSGGKQTEVFIQCLEL----------GHSADLRAIRASGPGCKRLGIDGDQDVIPFTLQIVYSKSTVSGR 739
gi 74746772 538 IYTVKIFFsdLSQDPTEDIFLIELKVkiqdskfpkdGFSPRRRGV-AEGPGAE--------------LSLCYQKALLSHR 602
                       810       820       830       840       850       860       870       880
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74716480 742 SRWSNLEKVCTSVNLNKACRKQEELDSSME------------ALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIG 809
gi 82081081 746 SQWNDVEKVCTSVNLSKACKKYEELASKTE------------CLNLTMTEVVKRQNSKSKKSFNQLSVSQIKVDKVQIIG 813
gi 83288385 740 SRWSNGEKVCTSVSLRKACNTYEELDSKME------------CLNLTVREVVKRQNSKTKKSFNQICTSHIKIDKAQIIA 807
gi 74746772 603 PREVTVSLRATGLILKAIPASDTEVSGSSHcplpaapvtdhtCLNVNVTEVVKSSN-LAGKSFSTV-TNTFRTNNIQIQS 680
                       890       900       910       920       930       940       950
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 74716480 810 SNSCpFAVCLDQDERKILQSVVRCEVSPCYKPEKSDLSSPPQTp-pDLPAQAAPDLCSL----LCLPIMTFSGALP 880
gi 82081081 814 VQSS-FAVCLDQDEQKILQSVTRCEISVCYRPRDSDPLALRRS---SLTPQDPSEFHSL----LCLPISTFSGALP 881
gi 83288385 808 QHGGtFPLCLDQDERKILQRVIKCEVSPCYKPEDRDFCRRNRRpswSQASQNQSEFCSL----LCLPIATFCGAQP 879
gi 74746772 681 RDQRlLTLSLDKDDQRTFRDVVRFEVAPC--PEPCSGAQKSKApwlNLHGQQEVEAIKAkpkpLLMPINTFSGIVQ 754
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap