Conserved Protein Domain Family
DUF2043

?
pfam09740: DUF2043 
Uncharacterized conserved protein (DUF2043)
This is a 100 residue conserved region of a family of proteins found from fungi to humans. This region contains three conserved Cysteines and a motif of {CP}{y/l}{HG}.
Statistics
?
PSSM-Id: 255523
View PSSM: pfam09740
Aligned: 9 rows
Threshold Bit Score: 167.226
Threshold Setting Gi: 74859106
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:
pfam09740 is a member of the superfamily cl10724.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 391358164 502 ERARAPIVPFGVDLCYWGQEQLTAGKILKSDSQHRFWKPSEvEEEVDSAHVSEMLHSRHITFSGTFEPVQHK-CRALRPN 580
gi 391359409 373 EEPKVKFVSFGLDLKYWGEERKDVEVPKNNADCHRFWRSAD-ESTVAGTVHDTVYTQRQFTFVGEAPKIDRE-CLAKLPS 450
gi 74966552  398 KPVKIKTVPFGLDLKYWGEERKDVEVPKNNADCHRFWRSAD-EGTVAGKAQQSIYTQRQYTFIGKAPDNRKV-CLAKMKS 475
gi 74859106  375 LLKRAPIVPMDPTLLFWGQKEIVLD--TGINREHRFLG--EgSEATISIENYNKLNQVTYTLEDEVDTTPSMaCNFPLKN 450
gi 75126241  321 LHAEAPVLPWSSVLDRWGSNRDALVNQRGLELESH-WGRVDnDAVIPAAKIAELNVHSSIYREDPVEILP---CLAPLKK 396
gi 75183593  407 LISEAPVMNWGSQLTNWESTTEVRANYRGLEIESH-WGRVDqDAIIPADKIAELNLQATVYREERTETPP---CRASLKK 482
gi 296434546 495 ERARAPVVPYGVDLHYWGQELPTAGKIVKSDSQHRFWKPSEvEEEVVNADISEMLRSRHITFAGKFEPVQHW-CRAPRPD 573
gi 82269437  423 KIENIPVVPFGLDLYYWGKEHPNSGKIFKLPSQHQFWAHAPmEEEVENAELLAESKSRCISFPGSFTPVSHF-CRARLDN 501
gi 391359411 501 ASFKAPVIPFGMDLYYWGEEQPTAGKIIKQTSQHQFWVPHEvEEEVENKELSAQMKSRCITYAGKFKPVEHK-CKAPMPN 579
                         90       100       110
                 ....*....|....*....|....*....|..
gi 391358164 581 GRLCERQDRLKCPFHGKIIPRDDKGQPLNPED 612
gi 391359409 451 GALCKRKDMFKCPLHGPLVDRDANGKPVKDED 482
gi 74966552  476 GKLCPRKDYYTCPLHGKIVDRDDEGRPINEED 507
gi 74859106  451 GSLCQRRDKEICPFHGKIIPRDDITGEILNED 482
gi 75126241  397 GGLCQRRDLKICPFHGPIVPRDAEGNPIHQSD 428
gi 75183593  483 GGLCQRRDLRVCPFHGPIVPRDDEGNTIIQES 514
gi 296434546 574 GRLCERQDRLKCPFHGKIVPRDDEGRPLDPED 605
gi 82269437  502 GLLCQRQDRLKCPFHGRIIPRDDVGLPINEED 533
gi 391359411 580 GSLCERQDRVKCPFHGHIIPRDELGRPVNPED 611
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap