NCBI CDD Logo
?
FERM adjacent (FA)
This region is found adjacent to Band 4.1 / FERM domains (pfam00373) in a subset of FERM containing protein. The region has been hypothesised to play a role in regulatory adaptation, based on similarity to other protein kinase substrates.
Statistics
?
PSSM-Id: 255008
View PSSM: pfam08736
Aligned: 44 rows
Threshold Bit Score: 53.0262
Threshold Setting Gi: 122121362
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:

pfam08736 is a member of the superfamily cl07378.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 75150627   356 GKLFgnTRGSSFRYHGRTQKQLIEYIRDYHKKREPFARPLKPEYNTYQQ 404
gi 82251804   329 SNLF--FKGSRFRYSGRVAKEVMELSAKIKREPPEIHRLTLALLCPCLS 375
gi 122068140  367 GLFP--RLGSKFRYSGRTHYETRKTPVD--RPAPDFKRSLTGKRLSSRS 411
gi 20454793   322 KMFP--VFGSTYRYKGRTQAESTNTPVD--RTPPKFNRTLSGARLTSRS 366
gi 122109440  322 TMFP--RFGSKYRYKGRTQYETRATPVD--RTAPKFDRTLSGARLTSRS 366
gi 82259583   235 KKLL--SLGSKFRYSGRTQIQSRRASAQISRPPPRFPRCSSRRSMLSRS 281
gi 82185346   367 KRFL--TLGSKFRYSGRTQAQSRRASSQIARAAPHFQRTTSRRHTVTAS 413
gi 59797482   499 SKFL--ALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRASRSLD 545
gi 432101439  322 KGFL--VMGSKFRYSGRTQAQTRQASALIDRPAPFFERSSSKRYTMSRS 368
gi 26336324   219 SNLF--FKGSRFRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRSCPS 265
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap