Conserved Protein Domain Family
PIG-P

?
pfam08510: PIG-P 
PIG-P
PIG-P (phosphatidylinositol N-acetylglucosaminyltransferase subunit P) is an enzyme involved in GPI anchor biosynthesis.
Statistics
?
PSSM-Id: 254844
View PSSM: pfam08510
Aligned: 38 rows
Threshold Bit Score: 90.7972
Threshold Setting Gi: 74862019
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam08510 is a member of the superfamily cl20360.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122118326  10 PSRAIYGFCLFLLFKTLFILYVLWTFIPTSILDGFGLTYLPDKYFALFIPILVLVgLTFFAFLIYPSLSLAMMPDVASVC 89
gi 122100434  26 HQVAINGFITWILVTMSLVVYFLWAFIPTSFLDMVLASYYPDKYWAVAIPAILVM-TMVYYLTVHFLLMLYRTDPLTDGF 104
gi 122043266  20 HNVAINGFIAWLLIITVFVAYFFWAFLPRHVLDRTLMSYYPDKYWAVALPAILVI-STVYYLSTSFLLVLHRTNPLTDGF 98
gi 124462811   2 KSIEIYGFIGWISSYIVFVVYLAWVFLPESAFHSLGIHYFPQKYWALAIPSFFVA-TIFTVITGYAALNYCFCNKLDSYE 80
gi 74861300  345 ANTEVYGFVYWIATFLGYILYLLWAFIPESVLSELGVHYYPSKYWAIAIPMYLVV-CAIFGLVVYFCINLIITEPLESFN 423
gi 74777751    4 TLTQKTKYFNSINCCFNLVVYLCWMFIPDEYLNQINITYYPDRMWGITVPIYMLF-LPFMTIITYNCISILNVRPTNSFD 82
gi 121959646 372 MSAEVYGFVSWIASFAAFLFFFLWAVVPHRYFHQVSITYLVDPYWALAFPVILLI-CLATTFFLYTASTLLKTQPLESFS 450
gi 9973048    12 KTSEVYGFVGSISIVVATVIFLIWGYVPDKFLESIGIYYYPSKYWAMAMPMYSMV-TLLVALVFYIGLNFMSTSKPTSLN 90
gi 74862019    3 SIKEGYAFFILYLSQILWALYLIWAFIFDDILIL-LYFPFPSKYWAAVIPCAIIF-TCFCFFLFTIIYSYVQTEPPHSMD 80
gi 154346360  84 aQVAINGFIGSILIVVGSIVYVLWSVLPDEVLHRMHMTYYPDRYWAVAVPAILVM-FLVHYFTTSWLLVLVTTHPLTDGR 162
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122118326  90 T---------ITDRFTIVRCQYQYPDRQRCNQkidavyrdswaakpfcskhsirvttasdlrssvrisnycdcpeeercl 160
gi 122100434 105 C---------VAQTNGAVRHESIENLVDVEDG------------------------------------------------ 127
gi 122043266  99 C---------VADADAKEDYHGLESLSEAKEG------------------------------------------------ 121
gi 124462811  81 N---------VEDKYTRLHNLKKTELHEG--------------------------------------------------- 100
gi 74861300  424 T---------FKDQFSHEADHAFAYLPES--------------------------------------------------- 443
gi 74777751   83 L---------IIDESTRYIDLSFLYKFEDLEQiksickstlkiytmvnk------------------------------- 122
gi 121959646 451 LlpgrahlaaMPDKMTAVLWSAADLSSQAIVDiatkrkkcyedps----------------------------------- 495
gi 9973048    91 T---------LFDDYSREDVNFLPLMKNGEDRp----------------------------------------------- 114
gi 74862019   81 L---------VKDKYSTFENLITEHS------------------------------------------------------ 97
gi 154346360 163 C---------ITDEDSKPDTEIEVGALADSGSs----------------------------------------------- 186
                        170       180       190
                 ....*....|....*....|....*....|....
gi 122118326 161 lrkdpghlaklrakqmVPAVADLNMGEVSRVLYR 194
gi 122100434 128 ----------------VPPITDIPVSVASRLLFQ 145
gi 122043266 122 ----------------VPPITEIPVSVASRLLFQ 139
gi 124462811 101 ----------------LPEVYDIPINVVNNVLYW 118
gi 74861300  444 ----------------IPPLEDIPIGVVNEILYQ 461
gi 74777751  123 npgekiteggrsdhekKYELYDDPKSAVIRQAFK 156
gi 121959646 496 ----svlpsppprriqVPEIYDLPPGALNRIMFP 525
gi 9973048   115 ----------------IDPISDIDITRINDLMFD 132
gi 74862019   98 ----------------MNCMNDISIEQINKLFYD 115
gi 154346360 187 ----------------LPPWVDIPVSVASHLLFE 204
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap