NCBI CDD Logo
?
pfam05781: MRVI1 
MRVI1 protein
This family consists of mammalian MRVI1 proteins which are related to the lymphoid-restricted membrane protein (JAW1) and the IP3 receptor associated cGMP kinase substrates A and B (IRAGA and IRAGB). The function of MRVI1 is unknown although mutations in the Mrvi1 gene induces myeloid leukaemia by altering the expression of a gene important for myeloid cell growth and/or differentiation so it has been speculated that Mrvi1 is a tumor suppressor gene. IRAG is very similar in sequence to MRVI1 and is an essential NO/cGKI-dependent regulator of IP3-induced calcium release. Activation of cGKI decreases IP3-stimulated elevations in intracellular calcium, induces smooth muscle relaxation and contributes to the antiproliferative and pro-apoptotic effects of NO/cGMP. Jaw1 is a member of a class of proteins with COOH-terminal hydrophobic membrane anchors and is structurally similar to proteins involved in vesicle targeting and fusion. This suggests that the function and/or the structure of the ER in lymphocytes may be modified by lymphoid-restricted resident ER proteins.
Statistics
?
PSSM-Id: 253382
View PSSM: pfam05781
Aligned: 3 rows
Threshold Bit Score: 732.208
Threshold Setting Gi: 75050786
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:

pfam05781 is a member of the superfamily cl20306.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373427  22 YGEVKDGALDVKRQHKCPGPTSGPSPGTNLSGCIRMNDDPSMEENGVERVCPESLLQSR----EYSSLPlprhTSSTDGT 97
gi 73621179    9 EQEPEDGALDVTRGCQCPLPTEDSILGQELLDCTRMNEDQSTDENGAGHFYSESPSQLReyltQPSSEQ----TSSSEST 84
gi 75050786  319 SPQPGPVESELGKPLAKTAKEGNPLPRGPTQGSGGVAPQASQGKSTVGEPAGSKVGSKAelwpPTSRPPllrgVSWDSGP 398
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373427  98 ITSSDPGLEILNMASCDLDRNSLCKKEEDTRSASPti-----------eAQGTSPAHDNIAFQDSTSKDKTILNLEAKEE 166
gi 73621179   85 VTSSESGSDILHMASGDLDCKPLCEKEEEARAASA--------------MQGTSLAPAAYGDYTSVGVAKAASQLEAGEE 150
gi 75050786  399 EEPGPRLQKVLAKLPLAEEEKRFTGKAGSKLAKAPglkdfqiqvqpvrmQKLTKLREEHILLRNQNLVGLKLPELSEAAE 478
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373427 167 PE-------TIEEHKKEHASGDSVVSPLPVTTVKSVNLRQSENTSA---NEKEVEAEFLRLSLGFKCDWFTLEKRVKLEE 236
gi 73621179  151 LR-------TTENGGKGSAPGETEISMPPKASVKLVNFQQSENTSA---NEKEVEAEFLRLSLGLKCDWFTLEKRVKLEE 220
gi 75050786  479 QEkghpselSSAIEEEESKGGLDVMPNISDVLLRKLRVHKSLPGSApplTEKEVENVFVQLSLAFRNDSYTLESRINQAE 558
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373427 237 RSRDLAEENLKKEITNCLKLLESLTPLCEDDNQAQEIIKKLEKSIKFLSQCAARVASRAEMLGAINQESRVSKAVEVMIQ 316
gi 73621179  221 RSRDLAEENLKKEITNCLKLLESLTPLCEEDNQAQEIVKKLEKSIVLLSQCTARVASRAEMLGAINQESRVSRAVEVMIQ 300
gi 75050786  559 RERNLTEENTEKELENFKASITSSASL-WHHCEHRETYQKLLEDIAVLHRLAARLSSRAEMVGAVRQEKRMSKATEVMMQ 637
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373427 317 HVENLKRMYAKEHAELEELKQVLLQNE--RSFNPLEDDDDCQIKKRSASlnSKPSSLRRVTIASLPR------------- 381
gi 73621179  301 HVENLKRMYAKEHAELEDLKQALLQNDrsFNSLPDEDDCQIKKRSSSLN--SKPSSLRRVTIASLPR------------- 365
gi 75050786  638 YVENLKRTYEKDHAELMEFKKLANQNSs-RSCGPSEDGVPRTARSMSLSl-GKNMPRRRVSVAVVPKfnilnlpgqspss 715
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373427 382 -------------NIGNAGMVAGMENNDRFSRRSSSWRILGSKQSEHRPSLPRFISTYSWADAEEE----------KCEL 438
gi 73621179  366 -------------NLGNVGLVSGMENNDRFSRRSSSWRILGTKQGEHRPSLHRFISTYSWADAEDE----------RSDV 422
gi 75050786  716 spipslpalsessNGKGNPPVSSALPALLENGKTNGDPDCEASASVPTPSCLEGISQEAKARMEEEaynkgyqeglKKTK 795
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373427 439 KTKDDSEPSGEETVERTRKPSLSEKKNNPSKWDVSSVYDTIASWATNLKSSIRKAN---KALWLSIAFIVLFAALMSFLT 515
gi 73621179  423 KARDAPEPQGEEAVERTRKPSLSERRSSTLAWDRGTICSSVASWVTHLQASFRRAN---RALWLTGLIIILIAALMSFLT 499
gi 75050786  796 ELQGLREEEEE---QKSESPEEPEEVAETEEEEKEQRSSKLEELVHFLQVMYPKLCqhwQVIWMMAAAMLVLTVVLGLYG 872
                        570       580       590       600
                 ....*....|....*....|....*....|....*....|.
gi 317373427 516 GQLFQKSVDAAPTQQEDSWTS-LEHILWPFTRLRHNGPPPV 555
gi 73621179  500 GQLFQTAVEAAPTQEGDSWLS-LEHILWPFTRLGHDGPPPV 539
gi 75050786  873 S--HNSCVEQADGSLGKSTCSaAQRDSWWSSGLQHEQPTEQ 911
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap