NCBI CDD Logo
?
pfam05291: Bystin 
Bystin
Trophinin and tastin form a cell adhesion molecule complex that potentially mediates an initial attachment of the blastocyst to uterine epithelial cells at the time of implantation. Trophinin and tastin bind to an intermediary cytoplasmic protein called bystin. Bystin may be involved in implantation and trophoblast invasion because bystin is found with trophinin and tastin in the cells at human implantation sites and also in the intermediate trophoblasts at invasion front in the placenta from early pregnancy. This family also includes the yeast protein ENP1. ENP1 is an essential protein in Saccharomyces cerevisiae and is localized in the nucleus. It is thought that ENP1 plays a direct role in the early steps of rRNA processing as enp1 defective yeast cannot synthesize 20S pre-rRNA and hence 18S rRNA, which leads to reduced formation of 40S ribosomal subunits.
Statistics
?
PSSM-Id: 253135
View PSSM: pfam05291
Aligned: 21 rows
Threshold Bit Score: 366.988
Threshold Setting Gi: 159115954
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:

pfam05291 is a member of the superfamily cl05044.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121929874 135 FIPtdENPivwpgeeaqpqgpGTDLAALILEKIAAHEASDgavkq-preiLGGGDAEDAVELP-----AKVVDVYSKIGL 208
gi 74604664  120 YFN--EDE-------------PVSLADKIMAKIREKEEEEqfertgeapgTSQGLEGEGVMLP-----PKVIAVYEKVGE 179
gi 74693041  129 YFK--RSSdfns------angTYILADKIMAAIREKEMEMkv------kaQAAQAGDAGMPSEgvalpERVIRAYTTVGS 194
gi 74604052  132 YFA--SNGpg---------ngSINLADKIMAKIQEKETIK----------ENNSRPVDAVLLP-----PKVISAYEKIGQ 185
gi 124460216 137 FMVg-----------------NDTKTNQIIEDFQ----------------KGLQDDENKKHHEnimnnPKVVCVYENVAE 183
gi 74863394  125 TNT--EEDv-----------dSKDIFEELNIKIMNDSKHVsy-------nKMENTTQEPNPSTedkvnLLVEKCYRTIGE 184
gi 74852569  166 FMGggGGDgqeq-----qfqtRFTLGDIIESKLKEHESRQ--------------------VSSenainPKVIDVYTKVGK 220
gi 3929393   138 FLPtvSGEegdl-----teekTTSLSDLIMQKINEAEARArg-------eYIPSAEEEENALPpl--pPKVIEVYSKVGV 203
gi 74685624  147 MGQdqGEEdg----------ePKTLADMIFSKMQGGAVS-----------RGVVDEHEGPPDPrkglnPKVVEVYSKVGF 205
gi 74701857  323 FGG--RG--------------NKTLADLIMEKIEAAEASGd---------GPSAQELEERRMPpg-inPKVIEVYRKVGE 376
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121929874 209 IMSRYKSGKLPKPFKILPTIPAWETLLGITRPENWTPNAMFAATRIFISS-KPQTAQIFLNTVLLPAVQDNIN--ETHKL 285
gi 74604664  180 LLSRYKSGKLPKAFKIVPTLRNWQDVLYVTDPASWSPNAIYEGTKMFVSNqQAKEAQKFIQIVLLERFKEEIE--EKKTL 257
gi 74693041  195 ILKTWTHGKLPKLFKVIPSLNNWEDVLYVTNPEAWSPHVVYEATKLFVSNlSAKGAQKFINMVLLERFRENIEtsEDHSL 274
gi 74604052  186 ILSTYTHGKLPKLFKVLPSLRNWEDVLFVTNPEKWTPHAVYEATKLFVSNlQANEAQKFVEMVLLERFRTSIEdsEDHSL 265
gi 124460216 184 LMKTYRSGKLPQPFHLIPKLEHWKQVFELTKPSEWSPQAIFAATKIFSSAlDRQQTEYLYSTVILPAIRLSIQ--EDKRL 261
gi 74863394  185 DLAHYKSGKLHRALTILTKSSKWYEYLLLTKPKKWTAHATFEITKLFSSGlKEKEVSKFYEFILLPIVLENID--KNKKL 262
gi 74852569  221 LLETYTSGKIPRAFRILPNFTNWEDLLYLTRPDKWTPHSIRVATKLFCMStNSKITQRFLSIVVLPRVRDNIA--EYKKL 298
gi 3929393   204 LLSKYRSGKIPKAFKIIPTLSNWEDILYLTRPDMWTPHACYEATRIFISNlKPVQAQHFLTVIILERVRDDIR--ENKKL 281
gi 74685624  206 LLSRYKSGPLPKALKILPSLPHWAQLLALTKPTEWTPHATFACTKIFVSNlKPTEVRVFLEGVLLDKCREDMRm-NNGKL 284
gi 74701857  377 LLSRYKSGPLPKAFKIVPSLPAWESILYITDPASWTPHATLAAVRIFVSTmKADQMQRFYELVLLDKVRDEIQ--DDGKV 454
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121929874 286 NVHYYNALKKALYKPSAFFKGLLFPLLTDgaCTQREAVIIASVVAKVSVPVLHSAVALHRCCEIaaeqmssdpDAAGPCN 365
gi 74604664  258 NYHVYRSLKKALYKPSAFFKGFLFPLAEQ--CTLKEAIIVSSILSKVSIPTLHSAAALMRLAEM---------PYSGPTS 326
gi 74693041  275 NYHIYRALKKSLYKLAAFFKGFLFPLVETg-CNVREATIAASVLARVSVPALHSSAALTYLLRL---------PFNPATT 344
gi 74604052  266 NYHIYRALKKSLYKPGAFFKGFLFPLVDSh-CSVREATIAASVLAKISVPVLHSSVALTQLVQR---------DFKPSTT 335
gi 124460216 262 NVHLYNALIKAMYKPQAWFRSILFPLCLEkdFTLKEAQIIGSVIHKLHVPPIHGSIAIFKVAQL---------DFTGPVA 332
gi 74863394  263 DAFLYKALIKALYKSKSWFKGILFPILHRe-CTKKQMIIIGSVIQKMSISINCVVLALDEIFSF---------SWNSIIS 332
gi 74852569  299 NYHLYMALKKSLYRPAAFYKAILLPLAESgdCTLLEAKIIGSVVCKVSIPVLHSSVALMKLSQLt--------RYNGATS 370
gi 3929393   282 NYHLYMALKKALYKPSSWFKGFLFPLVQEn-CTLREAAIIGSILQKVSVPVLHSAAALLRLTEF---------DLSGATS 351
gi 74685624  285 NVHLYEALKKGLYKPAAFFKGILFPLCETg-CSLKEAAIFASVLSKVSVPVLHSAAALLRLASM---------DYSGPNS 354
gi 74701857  455 SYQTYEAMKKAIYKPAAFFKGFLFPMCESgtLTLKEAAIVSSVLAKVSIPVLHSAAALLRLAEM---------EYSGPTS 525
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121929874 366 IFIKTFLEKKYALPFKVIDAVVFHFLRFRGVVtapdamdtestagdlggnGKLPVIWHQCLLAFAQRYRNDITEDQREAL 445
gi 74604664  327 LFIKVLLDKKYALPYRVVDAVVFHFMRFAHVE------------------EALPVIWHQSLLVFAQRYKSDITEDQRDAL 388
gi 74693041  345 VFIKVLLEKKYALPYQTVDECVFYFMRFRAVDdgstg---------edatRVLPVVWHKAFLSFAQRYKNDITQDQRDFL 415
gi 74604052  336 VFIRVLIEKKYALPYQTLDELVFYFMRFRKAAqandsmi-----deekeePQLPVVWHKAFLSFAQRYKNDITDDQRDFL 410
gi 124460216 333 VILKVLIEKKFSLPERALDEVIKYFMRYENDQ------------------REMPVIWHQMILRVCELYQ--LKQDHKDQL 392
gi 74863394  333 YILILLFNKKYAFTKQCIDNCVNYFLRFENYQ------------------DVLSINWHKSLLTLVHNYRGLMCDTQVEAL 394
gi 74852569  371 MFIRMLCDKKYALPYRVIDGLVDHFVMFDEEV------------------RELPVLWHRALLSFVQRYKTDITKDQKEKL 432
gi 3929393   352 VFIRILLDKKYALPYKVLDSLVFYFMRWKSLE------------------RPLAVLEHQSMLVFAQRYKFDITPEQKDAL 413
gi 74685624  355 LFIRILLDKKYALPYKVVDALVFHFIRLANSPrsk------------dgeDKLPVLWHQSLLVFVQRYASDLTPDQKDAL 422
gi 74701857  526 LFIRVLLDKKYALPYKVVDSLVFHYLRFAEPNsgveld-------kitreRRMPVLWHQSMLVFAQRYKQDLTPDQKSAL 598
                        330       340       350
                 ....*....|....*....|....*....|....*
gi 121929874 446 LDLLLSRGHKSISPEVRRELLEGRGRGVMLEPAPV 480
gi 74604664  389 LDVIKVKNHPKITPEIRRELISGESRPIVDEQMEV 423
gi 74693041  416 LETVRQRGHRDIGPEIRRELLAGKSREFVSDVGNT 450
gi 74604052  411 LETVRQRFHHAIGLEIRRELLAGKPRTPPQPVKEA 445
gi 124460216 393 KKLINKKKHHLITKEIQKQLKQRHQNGCRKMIINQ 427
gi 74863394  395 THLVKKKNHHQISSEIMKHLYSPTSLMNKGSEYIQ 429
gi 74852569  433 KIILRKHNHHIITAEIRRELFFSNSRGGVAPSNFT 467
gi 3929393   414 LEVVRLKGHYSIGPEIRRELLNSASRGEEIPVEME 448
gi 74685624  423 LDVIRARPHPTISSEVRREIVNSVERGAPRPEDGE 457
gi 74701857  599 LDLLRVQKHDGISPE--RE-----AKCWKNPWIKM 626
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap