NCBI CDD Logo
?
pfam03452: Anp1 
Anp1
The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.
Statistics
?
PSSM-Id: 251963
View PSSM: pfam03452
Aligned: 49 rows
Threshold Bit Score: 220.16
Threshold Setting Gi: 150864798
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:

pfam03452 is a member of the superfamily cl18230.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74695553  114 ELVSATVEQ--YDLRNYEGTPNGAENREHVLICIPLRNAHPV-----LP-----MMFKHLMNL---TYP--HELIDVAFL 176
gi 74586660  103 TSTNKKFKTnnIKVDEETGDTTEVVNKPTVLIMSVIGNNEPYgsdrhFD-----GFMLTILSL---VENqpDYEFSLGLL 174
gi 74623638   50 NLPADHISH--YDLNKLASTPMAAYNKERVLILTPM---AKF-----LD-----EYWDNLLKL---TYP--RELIELGFI 109
gi 74602400   70 DLPKNHISH--YDLNKLSATTNALGNREEVLILTPM---SKF-----LP-----QYWDNLVKL---TYE--HSLIELGFI 129
gi 125381317  65 NLPGDHIAH--YDLNKLASTPMAVYNKEKVLILTPV---SRF-----FN-----EYWQNLLRL---TYP--RELLELGFI 124
gi 190344750  67 NLPNKHISH--YDLNKLTATANGLANKEEVLLLSPM---SKF-----LP-----EYWDNINKL---SYD--HSLISLGFI 126
gi 68478711   67 DLPKNHISH--YDLNKLTASKDALNKREEVLILTPM---SKF-----LP-----EYWENINKL---TYD--HSLISLGFI 126
gi 150863957  69 NLPKNHISH--YDLNKLSTSADSLAKKEEVLILTPM---SRF-----TP-----QYWDNIQKL---TYE--HSLISLGFI 128
gi 149240993  76 DLPKNRISH--HDLNKLTTSPDALAKREELLILTPM---SKF-----LP-----EFWQNLNKL---TYD--HSLVSLGFI 135
gi 149236487  78 IENLTGLKKitYTLKQAENEKVSSSQKPTVLIVSSVGKDEPY-----GPgrsfeLFMDTILTLidnTDS--KYQFSLGLQ 150
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74695553  177 VSDCSENDKTLQSLMEYATYLQkgtlnnvlareeaeikrlkakhgngggdlylkymdqeylqmvrdafsppYHEN--YEK 254
gi 74586660  175 NNNEEEFIKIQDYFE---KNLQ-------------------------------------------------KELSetLSS 202
gi 74623638  110 VPRTADGDAALRKLETAVKKIQ-------------------------------------------------N-PKntKDT 139
gi 74602400  130 LPRTAEGDNALQQLESHVKKTQ-------------------------------------------------S-----SKD 155
gi 125381317 125 VPRNKDGDLALKKLEKAIKQIQ-------------------------------------------------T-GK--KEN 152
gi 190344750 127 IPRTNDGDEVLIKLEAAVKKTQ-------------------------------------------------A--D--KKT 153
gi 68478711  127 FPRTTQGDDALKELENALKK---------------------------------------------------TKRE--KRL 153
gi 150863957 129 LPRNKDGDVALKHLEEAIKDAK-------------------------------------------------AA----NQL 155
gi 149240993 136 FPRTEEGDVALKGVEHALKEAK-------------------------------------------------AKGT--LN- 163
gi 149236487 151 NNHLAEFNKIESHIAAKL-------------------------------------------------------ES--LAT 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74695553  255 PFRSVQVFKKDFGQKI-GQGFSDRHHVKVQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVE--LCPGSVIEDLMSIG 331
gi 74586660  203 IFKSISLISAPFLDQNtGFSREQRHDDHVQRLRRRLIAKSRNFLLLNTLN-LEQYVLSLDADMIrfDNPEKFIKAFIDSK 281
gi 74623638  140 KFAKVTILRQDTEALD-SQSEKDRHAFKVQKQRRSQMAVARNSLLFTTIGPYTSWVLWLDGDIV--ETPPTLIQDLVSHD 216
gi 74602400  156 KFKKITILRQDSGSLE-SQTEKERHALKVQKERRSMMALARNSLVFTTISPSTSWCLWLDADII--ETPPTLLQDLVSHN 232
gi 125381317 153 RFSKITILRQDTESLD-NQVEKHRHALKVQKDRRASMALARNSLVFSALGPYTSWVLWLDSDIV--ETPSTLIQDMVSHD 229
gi 190344750 154 RFKKVTILRQDSDSLS-SQAEKDRHALAVQKERRAMMAVARNSLVFSTISPSTAWCLWLDADIV--ETPPTLIQDLMRHD 230
gi 68478711  154 NFKKITILRQDSNSLQ-SQLEKDRHAFKVQKERRSMMALARNSLVFSTILPSTSWVLWLDADIV--ETPVTLIQDLTGHN 230
gi 150863957 156 KYKKITILRQDTNSLN-SQLEKDRHALNVQKERRSMMALARNSLLFTTIAPTTSWILWLDADIV--ETPAGLIQDLTSHN 232
gi 149240993 164 -WKKVTLLRQDSGSLE-SQLEKDRHAFNVQKERRSMMAIARNSLLFTTISTKTSWVLWLDSDIV--ETPPTLVQDMTAHN 239
gi 149236487 174 KFHKITLSSAPQLEGE-GVSRNDRHNDAMQRTRRRLIARSRNFLISQALA-DEQYIITLDSDIIgfEQGPKMLEIMINSN 251
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74695553  332 YDVIVPNVWRPLPEFL---G---GKQGYDLNSWI------ESTDALNL-AKKLEEDDVI---VEGYA-EYATWRFHLITA 394
gi 74586660  282 KDIIVPRIQRL------------DMQDYDKNSWRgqrtkpTKEQLEKMdNNQWDQWDYVprdVKDHMyHFQTYMDNKDNE 349
gi 74623638  217 KPVIAANCYQRYYDEE---KkqdAIRPYDFNNWV------ESEEGLRI-ASTMGDDEII---VEAYA-ELATYRPLMGHF 282
gi 74602400  233 KPVVSANVYQRFTDPN---TkqaAIRPYDFNNWV------ESETGLQI-AAGLKEDEIV---VEGYA-EMATYRPLMAHF 298
gi 125381317 230 KPVISANCYQRYFDEE---KkqdSIRPYDYNNWV------ESEEGLKI-AENMAEDEII---VEGYA-EIATYRPLMAHF 295
gi 190344750 231 KPIVSANVFQRFHNPD---TnkpDIRPYDFNNWV------ESEEGLKI-AASLKEDEII---VEGYA-EMATYRPLMAYY 296
gi 68478711  231 KPVVSANVHQRFINQD---TkqpDIRPYDFNNWV------ESEEGLKL-AASLPDDEII---VEGYS-EMVTHRALMAHF 296
gi 150863957 233 KPVISANVYQRYEDES---TqqpSIRPYDFNNWV------ESEEGLKI-AAGLADDEIV---VEGYA-EMATYRPLMAHF 298
gi 149240993 240 KPVLSANVYQRYYDEDlkkN---SIRPYDFNNWI------ESEEGLKI-ANEMADDEII---VEGYA-EIATYRPLMAHF 305
gi 149236487 252 RDIIVPRVTR---------G---GISDYDRNSWRgkrtkpLQEELDLMdANKWGEFRYVprdVQGEIyHFYMHVDSQLT- 318
                        330       340       350
                 ....*....|....*....|....*....|....*....
gi 74695553  395 RE-AKGNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFA 432
gi 74586660  350 YElHKEEYDYVVPLDSVGGAVLFAKSIVFKQGVIFPTSL 388
gi 74623638  283 YD-PNGDVNTEMQLDGVGGTCLLVKADVHRDGAMFPSFP 320
gi 74602400  299 YE-ADGDRNTEMALDGVGGGAVLVKADVHRDGAMFPSFP 336
gi 125381317 296 YD-PNGDVNTEMELDGVGGAAVLVKADVHRDGAMFPPFP 333
gi 190344750 297 YD-AKSDIHTEMALDGIGGGAVLVKADVHRDGAMFPSFP 334
gi 68478711  297 YD-PKGDPSTEMTLDGVGGGAVMVKADVHRDGAMFPSFP 334
gi 150863957 299 YD-AKGDVHTEMQLDGVGGGAVMVKADVHRDGAMFPSFP 336
gi 149240993 306 YD-AKGDANTEMALDGVGGGAVLVKADVHRDGAMFPSFP 343
gi 149236487 319 -D-EQKQLNYAVPLDSVGGAVLFFKSIVFKQGANFPTSY 355
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap