NCBI CDD Logo
?
pfam03164: Mon1 
Trafficking protein Mon1
Members of this family have been called SAND proteins although these proteins do not contain a SAND domain. In Saccharomyces cerevisiae a protein complex of Mon1 and Ccz1 functions with the small GTPase Ypt7 to mediate vesicle trafficking to the vacuole. The Mon1/Ccz1 complex is conserved in eukaryotic evolution and members of this family (previously known as DUF254) are distant homologues to domains of known structure that assemble into cargo vesicle adapter (AP) complexes. describes orthologues in Fugu rubripes.
Statistics
?
PSSM-Id: 251768
View PSSM: pfam03164
Aligned: 7 rows
Threshold Bit Score: 517.71
Threshold Setting Gi: 347595671
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:

pfam03164 is a member of the superfamily cl20246.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 347595671 171 CKLNESQTLCDKNFFIFTSAGKPIYCMH-GKDEQIMSYTGLVNTVISYFQVNGpseLKTISTLTSGKRLTFLDKSPILLM 249
gi 1723226   103 SLISFDLAKQKRTYLIFSSSGKPVFSNI-VDDSIEPSTVGALQAIISSFEVSK---EELTSFSTFSNVIVVLSKNPLYLV 178
gi 75021361   38 DVIFEHLEQLPFQVFILSEFGKPIFVNNdRNEGEIVSLVALICAFVSRCQSWG---DSLMTMTSQDNHIQFLHKSPLIFC 114
gi 74870497  106 YQHDSLWQGQKKHIFILSEAGKPIFSLH-GNEDKLATLFGVIQALVSFVQMGQ---DAITSIHAGGIKFAFMQRSSLILV 181
gi 74738536   99 DPSDEEWRSQRKHVFVLSEAGKPIYSRY-GSVEALSATMGVMTALVSFVQSAG---DAIRAIYAEDHKLVFLQQGPLLLV 174
gi 82177758  110 DMSSEAWRSHRKHVFVLSEAGKPIYTRY-GSEEALSSTMGVMMALVSFVESDK---NTIRSIHADGCKVIFLAKSPLVLV 185
gi 146324996 145 EDATEAWRLHQKHVFVLSEAGKPVYSRY-GSEEALSSTMGVMVALVSFLEADK---NAIRSIHADGYKVVFVRRSPLVLV 220
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 347595671 250 AQSERGES-SNELLNQLDFLYSYILSSLSERQLLRLFSKR-ENFDLRNYLESTDFENLDEIc----sLICNRMFPDLLLN 323
gi 1723226   179 GVSPSTTLsAAYLLSELNLLYCQILTGVTAKAMQLTLNSR-PNFDLRRLIGSNEQFLKELC------DQLNDYELVPTLN 251
gi 75021361  115 VVSKYPEQ----LDQQLEVLFEQICSILSKSQLENVYKKKgDNYDLRKLLRGTDRLIDSSI------SSWRASPINLVDS 184
gi 74870497  182 AASRSNMS-VQQLQLQLGDVYNQILSILTYSHMTKIFERR-KNFDLRRLLSGSERLFYNLLandsssAKVSNNIFTFLTN 259
gi 74738536  175 AMSRTSQS-AAQLRGELLAVHAQIVSTLTRASVARIFAHK-QNYDLRRLLAGSERTLDRLL------DSMEQDPGALLLG 246
gi 82177758  186 GVSQTYQS-DKELLRELQYIYYQIVSLLTLTQLNHIFQNK-QNYDLRRLLAGSEYLTDNLL------HRLDRDP-GLLLS 256
gi 146324996 221 AVARTRQS-AQELAQELLYIYYQILSLLTGAQLSHIFQQK-QNYDLRRLLSGSERITDNLL------QLMARDP-SFLMG 291
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 347595671 324 SLQCLPFNHSSRLKLQNVVLQqlekrqdIPRGTLLYGLIIAPqNKLCCVLRPRGHT----LHTTDLHLLFCLISHqfQNL 399
gi 1723226   252 AISPLPLRSSFRDQLSQLLLR-------ETPKSLLFTFIAIR-GRLVCMVKAKKLL----LHANDLYLLFLSLFRt-QSF 318
gi 75021361  185 SISAIPMNPSDREFLSTTMAScl---gaAKLDGALFGIMIAR-RQIAAMVRFKKYM----IHPRDLNIVINLVSD--NTL 254
gi 74870497  260 SIRVFPLPTTIRSQITSAIQSn-----cSKIKNLVFAVLIAN-NKLIALVRMKKYS----IHPADLRLIFNLVEC--SES 327
gi 74738536  247 AVRCVPLARPLRDALGALLRR-------CTAPGLALSVLAVG-GRLITAAQERNVLaecrLDPADLQLLLDWVGA---PA 315
gi 82177758  257 AVTCLPLSNSVRDVVSSSLQA-------AKAKNLVFSILLAG-DRLVTLVRKKDQF----LHHIDLHLVMNLVGS--SSS 322
gi 146324996 292 AARCLPLAAAVRDTVSASLQQ-------ARARSLVFSILLAR-NQLVALVRRKDQF----LHPIDLHLLFNLISS--SSS 357
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 347595671 400 DETQELWVPICFPKFNSSGFLYCYIKF-LPNdthsneKSALVLISAQKDAFFSLKSFSDELIIKLEE-----EKLLKKIN 473
gi 1723226   319 NDSMEHWVPVCFPTLNPDAYIYIYSYF-LCK------DTVLIMGSSESGVFFEMQSVKCKVAQEIQDhg-wlKKLIYCEE 390
gi 75021361  255 QTDSQNWVPICLPRFNDTGFFYAYISYpWCNkeq-diPVCIVLLSVKRDHFDGLKEVRQQIVTKLENnqkffVNFAQAMK 333
gi 74870497  328 FKSSENWSPICLPKFDMNGYLHAHVSY-LADd----cQACLLLLSVDRDAFFTLAEAKAKITEKLRKsh-clEAINEELQ 401
gi 74738536  316 FAAGEAWAPVCLPRFNPDGFFYAYVAR-LDAm-----PVCLLLLGTQREAFHAMAACRRLVEDGMHAlg-amRALGEAAS 388
gi 82177758  323 FREGEGWTPICLPKFNTAGFFHAHISY-LESa----sDLCLILVSTDREDFFNMSDCKQRFLERLTKrt-ayQALKEALK 396
gi 146324996 358 FREGEAWTPVCLPKFNAAGFFHAHISY-LEPd----tDLCLLLVSTDREDFFAVSDCRRRFQERLRKrg-ahLALREALR 431
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 347595671 474 Ts-------KGFKLSDIP--APMVHHFIYKS-------KQNVQYVMPHFEVNSNIALDSSqgleyelkLKTYYQQLHGTV 537
gi 1723226   391 M--------DRTTPRNPG--SPCISHYLFYS-------KKYSQFYTPGYSFSTPNFNTRT--------LYAIYASLHDQA 445
gi 75021361  334 Tp-------NLYQISQIGsnSESLWSFLYLN-------HSSKQVCMSASKIPLITRDERWiars-emrRSSSLSSLHPHL 398
gi 74870497  402 Qpf-----nAKLYQQVVG--IPELRHFLYKP-------KSTAQLLCPMLRHPYKSLTELEr-------LEAIYCDLLHRI 460
gi 74738536  389 FsnassasaPAYSVQAVG--APGLRHFLYKPldipdhhRQLPQFTSPELEAPYSREEERQr-------LSDLYHRLHARL 459
gi 82177758  397 C--------PSYSVEQVG--IPELRHFLYKS-------KSSGLYTSPEFPELYQSDEEQEr-------LMGLYQDLHSHL 452
gi 146324996 432 T--------PYYSVAQVG--IPDLRHFLYKS-------KSSGLFTSPEIEAPYTSEEEQEr-------LLGLYQYLHSRA 487
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 347595671 538 VRdngnlLSRSMLNFVRWSSKDNedlamdetqmdfseldeyiignssfkqesvnmvGMAWVTPTFELYLIGNnGIVDKRV 617
gi 1723226   446 FH-----KKNSFSINMTVHESLL---------------------------------LFTWSTASFDFHCIAN-ATTSSQL 486
gi 75021361  399 RT-----------LFVR-GTKHC---------------------------------LFVWVTDLFSLYCIFG-PFVTATI 432
gi 74870497  461 HN-----SSRPLKLIYEMKEREV---------------------------------VLAWATGTYELYAIFE-PVVDKAT 501
gi 74738536  460 HS-----TSRPLRLIYHVAEKET---------------------------------LLAWVTSKFELYTCLS-PLVTKAG 500
gi 82177758  453 HH-----PVRPLRFFYRCTNKEN---------------------------------LLAWVTNGFQLYLCFS-PLGTKAM 493
gi 146324996 488 HN-----ASRPLKTIYYTGPNEN---------------------------------LLAWVTGAFELYMCYS-PLGTKAS 528
                        490       500
                 ....*....|....*....|....*..
gi 347595671 618 LFKSARKVANWCQKHESRLFISDGAVF 644
gi 1723226   487 LIANVNKILRWIRREENRLFIQTNLSF 513
gi 75021361  433 AFQVVEKLLKSLKSHEQRYFIINSTSF 459
gi 74870497  502 VIKYVDKLIKWIEKEYDVYFIRNHATF 528
gi 74738536  501 AILVVTKLLRWVKKEEDRLFIRYPPKY 527
gi 82177758  494 AVSAVNKLLKWIRKEEDRLFILSPLTY 520
gi 146324996 529 AVSAIHKLMRWIRKEEDRLFILTPLTY 555
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap