Conserved Protein Domain Family
MIF

?
pfam01187: MIF 
Click on image for an interactive view with Cn3D
Macrophage migration inhibitory factor (MIF)
Statistics
?
PSSM-Id: 250427
View PSSM: pfam01187
Aligned: 6 rows
Threshold Bit Score: 181.094
Threshold Setting Gi: 2833295
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam01187 is a member of the superfamily cl22914.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1DPT_A         1 PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVgTAEDNRSHSAHF 80
gi 2833295     2 PMVRVATNLPNEKVPVDFEIRLTDLLARSMGKPRERIAVEIAAGARLVHGATHDPVTVISIKSIGAV-SAEDNIRNTAAI 80
gi 1169390     2 PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLISSIGVVgTAEQNRSHSSSF 81
gi 259016390   2 PYFTIDTNIPQNSISSAFLKKASNVVAKALGKPESYVSIHVNGGQAMVFGGSEDPCAVCVLKSIGCV-GPKVNNSHAEKL 80
gi 109940100   2 PMFVVNTNVPRASVPDGLLSELTQQLAQATGKPAQYIAVHVVPDQLMTFGGSSEPCALCSLHSIGKI-GGAQNRSYSKLL 80
gi 400257      2 PMFTIHTNVCKDAVPDSLLGELTQQLAKATGKPAQYIAVHIVPDQMMSFGGSTDPCALCSLYSIGKI-GGQQNKTYTKLL 80
                         90       100       110
                 ....*....|....*....|....*....|....*
1DPT_A        81 FEFLTKELALGQDRILIRFFPLESWQIGKIGTVMT 115
gi 2833295    81 TEFCGKELGLPKDKVVITFHDLPPATVGFNGTTVA 115
gi 1169390    82 FKFLTEELSLDQDRIIIRFFPLEPWQIGKKGTVMT 116
gi 259016390  81 YKLLADELKIPKNRCYIEFVDIEASSMAFNGSTFG 115
gi 109940100  81 CGLLTERLRISPDRIYINFCDMNAANVGWNGSTFA 115
gi 400257     81 CDMIAKHLHVSADRVYINYFDINAANVGWNGSTFA 115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D