NCBI CDD Logo
?
pfam00755: Carn_acyltransf 
Click on image for an interactive view with Cn3D
Choline/Carnitine o-acyltransferase
Statistics
?
PSSM-Id: 250110
View PSSM: pfam00755
Aligned: 17 rows
Threshold Bit Score: 682.872
Threshold Setting Gi: 83300864
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
pfam00755 is a member of the superfamily cl08288.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T1U_A       21 DLPKLPVPPLQQTLATYLQCMQHLVPE-EQFRKSQAIVKRFGAp-gGLGETLQEKLLERQEKT------ANWVSEYWLND 92
gi 2493497  172 SLPKLPVPRVSATIQRYLESVRPLLDD-EEYYRMELLAKEFQD---KTAPRLQKYLVLKSWWA------SNYVSDWWEEY 241
gi 56405343 170 SLPRLPVPAVKDTVNRYLQSVRPLMKE-EDFKRMTALAQDFAV---GLGPRLQWYLKLKSWWA------TNYVSDWWEEY 239
gi 74966534 147 LLPSLPVPALKDTISEYLDSMKHILSE-QEYEIVAKQAHEFLE---NEGKKLQRYTWIYSLFT------DNYVTSFWQKY 216
gi 74958597 140 LLPNLPLPALQDTVDRYVDSMKHLMSE-EDYDQLLEMSRKFVS---NEGRSIQRYAWFLHKFT------DNYVTSLWEQY 209
gi 1352614   19 SLPPLPVPSLEESLKKYLESVKPFANE-DEYKKTEEIVQKFQD---GVGKTLHQKLLERAKGK------RNWLEEWWLNV 88
gi 3024240   19 SLPSLPVPSLEESLKKYLESVKPFANE-EEYKNTEAIVWKFQN---GIGEKLQQKLLQRAKGR------RNWLEEWWLNV 88
gi 83300864   3 NLKRLPIPPLQDTLNRYLARVEPLQDE-RQNRRTRRTVL--SAenlDALNTLHERLLEYDARLaesnpeSSYIEQFWYDA 79
gi 1345654   73 DLPSLPVPELKSTLDKYLQTIRPFCNDvETFERQQLLCKDFSEh-mGP--ILQDRLKEYANDK------RNWMAKFWDEQ 143
gi 2493499   41 QLPKLPVPTLEETASKYLKTVEPFLNQ-EQLESTKAKVAEFVRp-gGAGEALQARLNNFAADK------DNWLAEFWDDY 112
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T1U_A       93 MYLNNR-LALPVNSSPa--VIFARQHFQDT---------NDQLRFAACLISGVLSYKTLLDSHSLPTDWAKGqlsGQPLC 160
gi 2493497  242 IYLRGR-SPLMVNSNY---YVMDLVLIKNT---------DVQAARLGNIIHAMIMYRRKLDREEIKPVMALG---IVPMC 305
gi 56405343 240 IYLRGR-GPLMVNSNY---YAMDLLYILPT---------HIQAARAGNAIHAILLYRRKLDREEIKPIRLLGs--TIPLC 304
gi 74966534 217 AYLHGR-YPLMINSS----VAHCDLLRDKE---------ATRAHRAARVTWIEVMSHLAIDRQQYK---ALG---DGLVC 276
gi 74958597 210 IYMAGR-YPLLINSS----VAQCTMYGESD---------LIQAYQVARLIYIETIANLALDRQKYM---AIG---EGLMS 269
gi 1352614   89 AYLDVR-IPSQLNVNFvgpSPHFEHYWPAR---------EGTQLERGSILLWHNLNYWQLLRREKLPVHKSG---NTPLD 155
gi 3024240   89 AYLDVR-IPSQLNVNFggpASHIEHYWPPK---------EGTQLERGSISLWHNLNYWQLLRKEKLAVEKVG---NTPLD 155
gi 83300864  80 YLLYDAtVVLNVNPYFqlqDDPTIKDTPETaaqgpygahTVQVRRAARLTTSILKFIRQIRHGTLRTDTVRG---KTPLS 156
gi 1345654  144 SYLQYNdPIVPYVSYFyshMPLPNHLSKID---------NDPLIKATAIISTVVKFIEAIKDESLPVEIIKG----MPFC 210
gi 2493499  113 AYMSYRdPVVPYVSYFfshKDVKN---IIG---------QDQLLKATLIAYYTIEFQEKVLDESLDPEVIKG----NPFC 176
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T1U_A      161 MKQYYRLFSSYRL---PGHT---QDTLVAQKSSImpe--peHVIVACCNQFFVLDVVIn---FRRLSEGDLFTQLRKIVK 229
gi 2493497  306 SYQMERMFNTTRI---PGKD---TDVLQHLSDSR-------HVAVYHKGRFFKLWLYEg---ARLLKPQDLEMQFQRILD 369
gi 56405343 305 SAQWERMFNTSRI---PGEE---TDTIQHMRDSK-------HIVVYHRGRYFKVWLYHd---GRLLKPREMEQQMQRILD 368
gi 74966534 277 TRHYKNMYAVTRE---PGKK---IDQLILHGIQK-------HIVVVLRGKYYKIHVVDd--kNNIYTVEQLTKIFHEMIS 341
gi 74958597 270 TRHYRNIYNGCRI---PGKQ---YDSFQWNKPAK-------HVILVHDCTWYKVDICDs--nGQLYTVDQLAKIVAEVMG 334
gi 1352614  156 MNQFRMLFSTCKV---PGIT---RDSIMNYFKTEseghcptHIAVLCRGRAFVFDVLHd---GCLITPPELLRQLTYIYQ 226
gi 3024240  156 MNQFRMLFSTCKI---PGIT---RDSIINYFRTEseghspsHLAVLCRGRVFVFDVMHe---GYLMTAPEIQRQLTYIQK 226
gi 83300864 157 MDQYERLFGSSRIppgPGEP---SCHLQTDATSH-------HVVAMYRGQFYWFDVLDtrnePIFATPEQLEWNLYSIIM 226
gi 1345654  211 MNSFSLMFNTSRL---PGKPednQDTNIFYSVYEn-----nFVTIAYKGKFYKLMTHDg--nDKPLSENEIWRQLYSVVF 280
gi 2493499  177 MNAFKYMFNNSRV---PAEg---SDITQHYNGEEn-----qFFVVIYKNNFYKVPTHKn---GQRLTKGEIYSYLQEIKN 242
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T1U_A      230 MASNEDERLPPIGLLTSDGRSEWAKARTVLLKDST--NRDSLDMIERCICLVCLDGP--GTGELSd-tHRALQLL----- 299
gi 2493497  370 DPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGK--NKAALEAIERAAFFVALDEEsySYDPED---EASLSLY----- 439
gi 56405343 369 NTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGK--NKQSLDAVEKAAFFVTLDET--EEGYRSedpDTSMDSY----- 439
gi 74966534 342 RDEKEEGVIGKIAALTHDTRDSWHRNRQKYFLGNVk-NAQILKEIECAVFFFTLDENd-DYGYDEk-kPEVLSNF----- 413
gi 74958597 335 RDDKSKGYLRNIASLTTDRRTEWCSNRQKFFLENKh-NQKLLQQIETAQFVMSVDGDl-NWGVET---TEQLSKY----- 404
gi 1352614  227 KCWN-EPVGPSIAALTSEERTRWAKAREYLIGLDPe-NLTLLEKIQSSLFVYSIEDTspHATPEN---FSQVFEM----- 296
gi 3024240  227 KCHS-EPDGPGVAALTTEERTRWAKAREYLISLNPe-NLTILEKIQSSLLVFCLDDDspHVTPED---YSQVSAK----- 296
gi 83300864 227 DAESAGSGSAPFGVFTTESRRVWSNIRDYLFHADDctNWRNLKLIDSALFVVCLDDVafAADQQDeltRSMLCGTstinl 306
gi 1345654  281 QGSQSDPKLGGIGSLTSLPRDQWREVHLELMKD-Pi-SQDSLETIHKSSFMLCLDLDqsPVTLEEk-------------- 344
gi 2493499  243 DAT---PKGLGLGALTSLNRDEWLSAYNNLLKS-Pi-NEASLGSIFASSFVIALDSNn-PVTIEEk-------------- 302
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T1U_A      300 ----HGGGCS---LNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMMTSNK--------------- 357
gi 2493497  440 ----GKALLH---GNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPIIGHLWEFVLGTDSFHLGyte------------ 500
gi 56405343 440 ----AKSLLH---GRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGyae------------ 500
gi 74966534 414 ----LANCLS---GDGTNRWVDKSLNYICSKNARCGGTTEHSIADGAEFDHIMENFVYVDLEVLKyksi----------- 475
gi 74958597 405 ----MKDMLA---GSGSNRWVDKTMNYAVDASGRAGATGEHSPCDGAELDHLCENVLNVDKQVLVspst----------- 466
gi 1352614  297 ----L--LG----GDPAVRWGDKSYNLISFANGIFGCSCDHAPYDAMLMVNIAH--Y-VDEKLLEte------------- 350
gi 3024240  297 ----I--LN----GDPTVRWGDKSYNLIAFSNGVFGSNCDHAPFDAMVLVKVCY--Y-VDENILEne------------- 350
gi 83300864 307 dphqHQPPLNvqtGTCLNRWYDK-LQLIVTKNGKAGINFEHTGVDGHTVLRLATDIYTDSILSFArgvtknvvdifsddd 385
gi 1345654  345 ----sRNCWH---GDGINRFYDKSLQFLVTGNGSSGFLAEHSKMDGTPTLFLNNY---VCQQLNKldvd----------- 403
gi 2493499  303 ----sKNCWH---GDGQNRFFDKPLEFFVSANGNSGFLGEHSRMDATPTVQLNNT---IYKQILEtnpn----------- 361
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T1U_A      358 -------KLVRAdsv---seLPAPRRLRWKCSPE-TQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKK-QKYSPDGF 425
gi 2493497  501 -----tgHCLGKpn----paLAPPTRLQWDIPKQ-CQAVIESSYQVAKALADDVELYCFQFLPFGKGLIKK-CRTSPDAF 569
gi 56405343 501 -----dgHCKGDin----pnIPYPTRLQWDIPGE-CQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKK-CRTSPDAF 569
gi 74966534 476 ----eeqEKMAVieendkksLKLATPLNFEVPDQeMLSEITRCYDAHQIAKNDLDLYALAFRDFGKGRIKK-CGVSPDAF 550
gi 74958597 467 ----eeqLEIIKmtfteknsLRLAQKLDFQEVDG-METEVNRCFEQHHKASDDLHMHSIAFTDFGKGRVKK-CGISPDGF 540
gi 1352614  351 ------gRWKGSekv---rdIPLPEELAFTVDEK-ILNDVYQAKAQHLKAASDLQIAASTFTSFGKKLTKK-EALHPDTF 419
gi 3024240  351 ------gRWKGSekv---rdIPVPEELVFTVDEK-VLNDINQAKAQYFKQVSDLQLVVYAFTSFGKKLTKE-KQLHPDTF 419
gi 83300864 386 gkpssssLASAAhsa---nlITIPRKLEWRTDNF-LQSSLHFAETRISDLISQYEFVNLDFSNYGASHIKTvFKCSPDAF 461
gi 1345654  404 ----dfmRKVITpss---tvAMKPMELPFIITPK-IHKAIESAQLQFKETIGEHDLRVWHYNKYGKTFIKR-HGMSPDAF 474
gi 2493499  362 ----dliVEIGSsa----prFGNAEILPFDINPT-TRANIKDAIAKFDATIAAHDEEIFQHYGYGKGLIKK-FKVSPDAY 431
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T1U_A      426 IQVALQLAYYRLYQRLVPTYESASIRRFQEGRVDNIRSATPEALAFVQAMTDhkAAMPASEKLQLLQTAMQAQTEYTVMA 505
gi 2493497  570 VQIALQLAHFRDRGKFCLTYEASMTRMFREGRTETVRSCTSESTAFVQAMME--GSHTKADLRDLFQKAAKKHQNMYRLA 647
gi 56405343 570 VQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVD--PAQTVEQRLKLFKLASEKHQHMYRLA 647
gi 74966534 551 IQMAIQLANYRDQGKFVLTYEPASARFFANSRTETLRTVNDHSCEFVEAMLN--ANETKEAKIALLKKACETHVLRNKKC 628
gi 74958597 541 LQMAIQLANYyDQGKFVLTYEPGSVRFYANSRTETLRPVTDYSCKFVQAMLS--DESTQKERRDLLKKACEAHVENCKEV 618
gi 1352614  420 IQLALQLAYYRLHGRPGCCYETAMTRYFYHGRTETVRSCTVEAVRWCQSMQD--PSASLLERQQKMLDAFAKHNKMMRDC 497
gi 3024240  420 IQLALQLAYYRLHGRPGCCYETAMTRLFYHGRTETVRPCTVEAVNWCQSMQN--PSTSLLERKHMMLEAFAKHNKMMKDC 497
gi 83300864 462 VQQVFQVAYFALYGRFETVYEPAMTKAFQNGRTEAIRSVTGQSKLFVKSLLD--QDASDATKIQLLHDACTAHSQITREC 539
gi 1345654  475 IQQVIQLAVFKYLKRQLPTYEAASTRKYFKGRTETGRSVSTASLEFVSKWQN--GDVPIAEKIQALKHSAKEHSTYLKNA 552
gi 2493499  432 VQLLMQLAYFKYTGKIRPTYESAATRKFLKGRTETGRTVSNESKKFVETWSD--PNASSADKVATFQAAAKQHVAYLSAA 509
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T1U_A      506 ITGMAIDNHLLALRELARD---LCKEPP--EMFMDETYLMSNRFVLS-----TS--QVPTTMEMFCCYGPVVPNGYGACY 573
gi 2493497  648 MTGAGIDRHLFCLYLVSKY---LGVSSPflAEVLSEPWRLSTSQIPQsqirmFDpeQHPNHLGAGGGFGPVADDGYGVSY 724
gi 56405343 648 MTGSGIDRHLFCLYVVSKY---LAVESPflKEVLSEPWRLSTSQTPQqqvelFDleNNPEYVSSGGGFGPVADDGYGVSY 724
gi 74966534 629 MVGQGVDRHLFVLYILSQG---TGIQSPflDNYINQKWKLSTSHVPNvt-nqCDedTDSDNTWLGACFGAVAADGYGICY 704
gi 74958597 619 MTGKGVDRHLFVLCVLAKG---LGYSSPflEEYANQKWLLSTSNIPNmt-nsVDedISEDNIMLGASFGAVAQDGYGICY 694
gi 1352614  498 SHGKGFDRHLLGLLLIAKE---EGLPVP---ELFEDPLFSRSGGGGNf----VLstSLVGYLRIQGVVVPMVHNGYGFFY 567
gi 3024240  498 STGKGFDRHLLGLSLIAKE---EGLPVP---ELFTDPLFSRSGGGGNf----VLstSLVGYLRVQGVMVPMVHNGYGFFY 567
gi 83300864 540 SQGLGQDRHLYALYCLWNQwykDKLELP--PIFRDKSWTTMQNNVLS-----TS--NCGNPCLKSFGFGPVTANGFGIGY 610
gi 1345654  553 ANGNGVDRHFFGLKNMLKS---NDDQIP--PLFKDPLFNYSSTWLISt----S---QLSSEYFDGYGWSQVNDNGFGLAY 620
gi 2493499  510 ADGKGVDRHLFGLKQMIQP---GEP-IP--EIFTDPIFSYSQTWYISs----S---QVPSEFFQSWGWSQVIDDGFGLAY 576
                       650       660       670
                ....*....|....*....|....*....|....*....
1T1U_A      574 NPQ-PEAITFCISSFHSCKETSSVEFAEAVGASLVDMRD 611
gi 2493497  725 MIAgENTIFFHISSKFSSSETNAQRFGNHIRKALLDIAD 763
gi 56405343 725 ILVgENLINFHISSKFSCPETDSHRFGRHLKEAMTDIIT 763
gi 74966534 705 RFGgNHGIFANITSYHSAANTDSTKFAKLLSESFHELSN 743
gi 74958597 695 RFAgNRAIMVHITSYHSSPATDSDRFGQHLREAIHTLAD 733
gi 1352614  568 HIR-DDRFVVTCSSWRSCLETDAEKLVEMIFHAFHDMIH 605
gi 3024240  568 HIR-DDRFVVSCSAWKSCPETDAEKLVQQVFHAFCDMMQ 605
gi 83300864 611 IIR---DHSVSVVVSS--RHRQTARFASLMEKSLLEIDR 644
gi 1345654  621 MLN-NEWLHINIVNKPAKSGASVNRLHYYLSQAADEIFD 658
gi 2493499  577 LIN-NDWIHVHISCKRGN-GLQSDHLKWYLVDSANEMKD 613
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D