NCBI CDD Logo
?
pfam00740: Parvo_coat 
Click on image for an interactive view with Cn3D
Parvovirus coat protein VP2
This protein, together with VP1 forms a capsomer. Both of these proteins are formed from the same transcript using alternative splicing. As a result, VP1 and VP2 differ only in the N-terminal region of VP1. VP2 is involved in packaging the viral DNA.
Statistics
?
PSSM-Id: 250098
View PSSM: pfam00740
Aligned: 24 rows
Threshold Bit Score: 492.634
Threshold Setting Gi: 81960642
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:

pfam00740 is a member of the superfamily cl08286.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2G8G_A         1 GADGVGNASGDWHCDSTWSE-----GHVTTTSTRTWVLPTYNNHlYKRLges--------------lqsNTYNGFSTPWG 61
gi 81938850   14 GGGGSNPVKSMWSEGATFSA-----NSVTCTFSRQFLIPYDPEHhYKVFspaasschnasgkeakvctiSPIMGYSTPWR 88
gi 81973706  243 GGGGSNPVHGVWREGAVFSE-----DSVSCTFSRVFVVPYAAEHsYRVFsppaenchsaaagesrvcavSPVMGYATPWH 317
gi 82011111   36 GGGGVGVSTGSYDNQTHYRFlgdgwVEITALATRLVHLNMPKSEnYCRIrvhnttdts---vkgnmakdDAHEQIWTPWS 112
gi 123868109  36 GGGGVGVSTGSYDNQTHYKFlgdgwVEITAYSTRIVHLNMPKSEnYCRVrvhnkndtd---vagqmaldDAHEQIWTPWS 112
gi 327478496 177 GGGGIGVSTGTYDNQTTYKFlgdgwVEITAHASRLLHLGMPPSEnYCRVtvhnnqttghgtkvkgnmayDTHQQIWTPWS 256
gi 81951254   35 GGGGVGVSTGTYDNQTTYRFlgdgwVEITAHASRLLHLNMPKSEnYCRVkvhnttdtg---qkgkmaldDTHEQIWTPWS 111
gi 123874586 185 GAGGVGVSTGSFNNQTEFQYlgeglVRITAHASRLIHLNMPEHEtYKKIhvlnsesg----vegqmvqdDAHTQMVTPWS 260
gi 81932480  177 GSGGVGISTGTFNNQTEFKFlengwVEITANSSRLVHLNMPESEnYRRVvvnnldkta---vngnmaldDTHAQIVTPWS 253
gi 116734273  36 GGGGVGVSTGTFDNQTHYRFlgdgwVEITAYSSRLLHLNMPTTEnYCRIrvnntdqtr---lkghmaydDSHEQIWTPWN 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2G8G_A        62 YFDFNRFHCHFSPRDWQRLINNNWGMRPKAMRVKIFNIQVKEVTT----SNG-ETTVANNLTSTVQIFADSSYELPYVMD 136
gi 81938850   89 YLDFNALNLFFSPLEFQHLIENYGSIAPDALTVTISEIAVKDVTD----KTGgGVQVTDSTTGRLCMLVDHEYKYPYVLG 164
gi 81973706  318 YIDVNCASLYFSPLEFQRLLENYGSIKPSSMSVTLSEICVKDVTD----KPGgGVQVTDSTTGRLCFLVDDTYQYPYVLG 393
gi 82011111  113 LVDANAWGVWLQPSDWQYICNTMSQLNLVSLDQEIFNVVLKTVTEqd-sGGQaIKIYNNDLTACMMVAVDSNNILPYTPA 191
gi 123868109 113 LIDSNAWGVWFQPSDWQFLCNNMSHMNLHSLDQELFNVVIKTVTEqn-pGPDaIKVYNNDLTASMMVALDSNNILPYTPA 191
gi 327478496 257 LVDANAWGVWFQPSDWQFIQNSMESLNLDSLSQELFNVVVKTVTEqqgaGQDaIKVYNNDLTACMMVALDSNNILPYTPA 336
gi 81951254  112 LVDANAWGVWFQPSDWQFIQNSMESLNLESFSQELFNVVVKMVTEqd-iAGTtSKVYNNDLTACMMVALDSNNILPYTPA 190
gi 123874586 261 LIDANAWGVWFNPADWQLISNNMTEINLVSFEQEIFNVVLKTITEs--aTSPpTKIYNNDLTASLMVALDTNNTLPYTPA 338
gi 81932480  254 LVDANAWGVWFNPGDWQLIVNTMSELHLVSFEQEIFNVVLKTVSEs--aTQPpTKVYNNDLTASLMVALDSNNTMPFTPA 331
gi 116734273 113 LVDCNAWGVWFQPSDWQFIQNTMSHFNLDTLDQEIFNVVVKTVTEqg-vGDQaMKVYNNDLTASMMVALDSNNILPYTPA 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2G8G_A       137 AGQEGSLPPFPNDVFMVPQYGY----------CGLVTGNTSq--QQTDR--------NAFYCLEYF-PSQMLRTGNNFEI 195
gi 81938850  165 QGQDTLAPELPIWVYFPPQYAYltvg--dvntQGISGDSKK---LASEE--------SAFYVLEHS-SFQLLGTGGTATM 230
gi 81973706  394 QGQDTLAPELPIWTYLLPQYAYltvg--dvntKGITSSSRK---QPTEE--------TAFYVLEHS-SCMLLGTGSSIST 459
gi 82011111  192 ANSMETLGFYPWKPTIASPYRYyfcvd-rdlsVTYENQEGTiehNVMGTpkg---mnSQFFTIENTqQITLLRTGDEFAT 267
gi 123868109 192 TDNQETLGFYPWKPTLPSPYRYyfncd-rdlsVTYANQTGTi-tNRMAAasg---msSQFFTIENTqRIQLLRTGDEFAT 266
gi 327478496 337 AQTSETLGFYPWKPTAPAPYRYyffmp-rqlsVTSSNSAEGt--QITDTigepqalnSQFFTIENTlPITLLRTGDEFTT 413
gi 81951254  191 AQTGETLGFYPWKPTAPAPYRYyfymp-rdlsVTYDNDTVQv-tDNAGGnvat-glnSQFFTIENTvPITLLRTGDEFAT 267
gi 123874586 339 APRSETLGFYPWLPTKPTQYRYylsctrnlnpPTYTGQSQQi-tDSIQTglh---sdIMFYTIENAvPIHLLRTGDEFST 414
gi 81932480  332 AMRSETLGFYPWKPTIPTPWRYyfqwd-rtliPSHTGTSGTp-tNIYHGtdp---ddVQFYTIENSvPVHLLRTGDEFAT 406
gi 116734273 192 AQTGETLGFYPWKPTVPTPYRYyfycs-rdlsVTYDNDQTQi-aDNMGQpng---lnSQFYTIENTlPITLLRTGDEFST 266
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2G8G_A       196 -TYSFEKVPFHSMYAHSQSLDRLMNPLIDQYLWGLQSTTTGTTLNAGTAtTnFTKLRPTNFSNFKKNWLPG-----PS-- 267
gi 81938850  231 -SYKFPPVPPENLEGCSQHFYEMYNPLYGSRLGVPDTLGGDPK---------FRSLTHEDHAIQPQNFMPG-----PLvn 295
gi 81973706  460 -SYAFPELPYESLEGAAQHFYEMYNPLYSSRLAVPSALGGQPK---------VRFVQPTDHALQPQNFMPG-----PMvn 524
gi 82011111  268 gTYYFDTNPVKLTHTWQTNRQLGQPP-------LLSTFPEADTDAGTLT---AQGSRHGATQME-VNWVSEairtrPAqv 336
gi 123868109 267 gTYYFETEPIKLSHTWQSNRQLGQPP-------QITELPTSDNDTATLV---ARGGRSGLTQIYGSNAVTEatrvrPAqv 336
gi 327478496 414 gTYIFNTDPLKLTHTWQTNRHLACLQ-------GITDLPTSDTATASLT---ANGDRFGSTQTQNVNYVTEalrtrPAqi 483
gi 81951254  268 gTYKFNTEPIKLTHTWQANRHLGMPP-------KLADLPGTDNQTGTLQ---AQANRFGMTQTQGVNYVTEalrirPAqv 337
gi 123874586 415 gIYHFDTKPLKLTHSWQTNRSLGLPP-------KLLTQPTTEGDQHTGTlP-AANTRKG-YHQTTNNSYTEatairPAqv 485
gi 81932480  407 gTFFFDCKPCRLTHTWQTNRALGLPP-------FLNSLPQAEGGTNFGYiGvQQDKRRGVTQMGNTNYITEatimrPAev 479
gi 116734273 267 gTYKFSTEPVKLTHTWQTNRHLGMPP-------QINTMPTADDQNGTLK---AQGDRFGQTQTQGVNNVTEalrirPAqi 336
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2G8G_A       268 ---IKQQGFSKTANQNYKIPATG----SDSLIKYETHSTLDGRWSALTPGPPMATAGPADSKFS---NSQLIFAGPKQNG 337
gi 81938850  296 --sVSTKEGDSSSTGAGKALTGLstgtSQNTRISLRPGPVSQPYHHWD-----TDKYVTGINAIshgQTTYG------NA 362
gi 81973706  525 --tVTTKEGDSSNTGAAKALTGFstgtSQNTRISFRPGPNSQPYHYYD---EAEQKYVNSIDSIshgVTTFGDRQKPNEA 599
gi 82011111  337 gfcQPHNDFEASRAGPFAAPKVP-----------ADVTQGVDREANGSVRYSYGKQHGENWAAHgpaPERYTWDETNFGS 405
gi 123868109 337 gfcQPHDNFETGRAGPFKVPVVP-----------ANITQGQDHDANGSLRYTYDKQHGQNYASNd-tRDRFTWDGISYDS 404
gi 327478496 484 gfmQPHDNFEANRGGPFKVPVVP-----------LDITAGEDHDANGAIRFNYGKQHGEDWAKQgaaPERYTWDAIDSAA 552
gi 81951254  338 gfmQPHDNFEANRGGPFKVPVVP-----------VDVTAGGDHDANGSIRFSYGRQHGHDSAAQs-eTERYTWDAIDDGA 405
gi 123874586 486 gynTPYMNFEYSNGGPFLTPIVP-----------TADTQYNDDEPNGAIRFTMGYQHGHLTTSSq-eLERYTFNP-QSKC 552
gi 81932480  480 gysAPYYSFEASTQGPFKTPIAA---------GRGGAQTDENQAADGDPRYAFGRQHGQKTTTTgetPERFTYIA-HQDT 549
gi 116734273 337 gfmQPHDNFEANRGGPFKVPNVP-----------ADITAGGDHDANGAIRFTLGKQHGQNWASHn-nNERYTWDAMHDGA 404
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2G8G_A       338 NTATV--PGTLIFTSEEELAATNATDTDMWGNLPGGDQSNSNLPTVDRLTALGAVPGMVWQNRDIYYQGPIWAKIPHTDG 415
gi 81938850  363 EDKEYqqGVGRFPNEKEQLKQLQGLNMHTYF-------PNKGTQQYTDQIERPLMVGSVWNRRALHYESQLWSKIPNLDD 435
gi 81973706  600 SES-----VGRYPNDKEQQKQLQALNIKTYY-------SNKGDQKYTEEINRPLMVGAVWNRRSFHYETQLWTKLPNLDE 667
gi 82011111  406 GRDTRdgFIQSAPLVVPPPLng--------ilTNANPIGTKNDIHFSNVFNSYGPLTAFSHPSPVYPQGQIWDKELDLEH 477
gi 123868109 405 GRWTDrcFIQSTPYTETPALnn--------ilTNSDPIGDKTDIHYQNVFNSYGPLSAFPHPAPIYPQGQIWDKELDLEH 476
gi 327478496 553 GRDTArcFVQSAPISIPPNQ-------NQILQ-REDAIAGRTNMHYTNVFNSYGPLSAFPHPDPIYPNGQIWDKELDLEH 624
gi 81951254  406 GRHTQdcFVQNVPLTVPPPLng--------ilSRRDPIGGKNDIHYPNIFNSYGPLSAFPHPDPIYPNGQIWDKELDLEH 477
gi 123874586 553 GRAPNqqFNQQAPLNLENTNng--------tlLPSDPIGGKPNMHFMNTLNTYGPLTALNNTAPVFPNGQIWDKELDTDL 624
gi 81932480  550 GRYPEgdWIQNINFNLPVTDdn--------vlLPTDPIGGKTGINYTNIFNTYGPLTALNNVPPVYPNGQIWDKEFDTDL 621
gi 116734273 405 GRHTQdcFVQSVPLTVPPNLns--------ilTRADPIGGKTGIHFPNIFNSYGPLTAFPHIDPVYPNGQIWDKEVDLEH 476
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2G8G_A       416 HFHPS-PLIGGFGLKHPPPQIFIKNTPVPANpatT-FSSt-PVNSFITQYSTGQVSVQIDWEIQ-KERSKRWNPEVQFT- 490
gi 81938850  436 SFKTQfAALGGWGLHQPPPQIFLKILPQSGPiggIk----sMGITTLVQYAVGIMTVTMTFKLGpRKATGRWNP--QPGv 509
gi 81973706  668 NFMAEfSALGGWALKTPPPMIFLKMQPAPGPegfSg-----ITNTTLAQYATGTLTVTLTFSLGpRKHTGRWNP--QPAv 740
gi 82011111  478 KPRLH-ITAPFVCKNNAPGQMLVRLGPNLTD---QyDPNg-ATLSRIVTYGTFFWKGKLTMRAK-LRANTTWNPVYQVSv 551
gi 123868109 477 KPRLH-VQAPFVCKNNAPSQLLVRLAPNLTD---QyDPNs-STLSRIVTYGTFFWKGKLTLKAK-LRPNATWNPVYQVSa 550
gi 327478496 625 KPRLH-VTAPFVCKNNPPGQLFVHLGPNLTD---QfDPNs-TTVSRIVTYSTFYWKGILKFKAK-LRPNLTWNPVYQATt 698
gi 81951254  478 KPRLH-ITAPFVCKDNPPGQLFVRLGPNLTD---QfDPNg-TTLSRIVTYSTFYWKGELKFRAK-LRPNSTWNPVYQMTs 551
gi 123874586 625 KPRLH-VTAPFVCKNNPPGQLFVKIAPNLTD---DfNADs-PQQPRIITYSNFWWKGTLTFTAK-MRSSNMWNPIQQHTt 698
gi 81932480  622 KPRLH-VNAPFVCQNNCPGQLFVKVAPNLTN---EyDPDasANMSRIVTYSDFWWKGKLVFKAK-LRASHTWNPIQQMSi 696
gi 116734273 477 KPRLH-VTAPFVCKNNPPGQLFVRLAPNLTD---QfNPEs-GTLSRIVTYATCYWKGKLTLKAK-LRPNSTWNPVYQISa 550
                        570
                 ....*....|....*...
2G8G_A       491 SNY------GQQNSLLWA 502
gi 81938850  510 YPP------HAAGHLPYV 521
gi 81973706  741 YPP------HAAGHLPYV 752
gi 82011111  552 EDNgns-ymSVTKWLPTA 568
gi 123868109 551 QYQsnndymSIHKWLPSA 568
gi 327478496 699 DSVans-ymNVKKWLPSA 715
gi 81951254  552 ADT------TIAKWLPTA 563
gi 123874586 699 TAE------NIGKYIPTN 710
gi 81932480  697 NVD------NQFNYVPSN 708
gi 116734273 551 ENHsqngymSVTKWLPTA 568
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D