Conserved Protein Domain Family
Hemagglutinin

?
pfam00509: Hemagglutinin 
Haemagglutinin
Hemagglutinin from influenza virus causes membrane fusion of the viral membrane with the host membrane. Fusion occurs after the host cell internalises the virus by endocytosis. The drop of pH causes release of a hydrophobic fusion peptide and a large conformational change leading to membrane fusion.
Statistics
?
PSSM-Id: 249917
View PSSM: pfam00509
Aligned: 15 rows
Threshold Bit Score: 774.215
Threshold Setting Gi: 122953
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:
pfam00509 is a member of the superfamily cl10565.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122953     18 ICTGITSSNSPHVVKTATQGEVNVTGVIPLTTTPTKSHFANLKgtktrGKLCPKCLNCTDLDVALGRPKCMGTIP-SAKA 96
gi 122929     19 ICIGYHANNSTTQIDTILEKNVTVTHSVELLENQKEERFCKIL-----KKAPLDLKGCTIEGWILGNPQCDLLLGdQSWS 93
gi 1346265    20 ICVGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCSLN-----GIAPLQLGKCNVAGWLLGNPECDLLLTaNSWS 94
gi 160332312  19 ICIGYHANKSTKQVDTIMEKNVTVTHAQDILERTHNGKLCSLN-----GVKPLILRDCSVAGWLLGNPMCDEFLNvPEWS 93
gi 122912     18 ICIGYHANNSTEKVDTNLERNVTVTHAKDILEKTHNGKLCKLN-----GIPPLELGDCSIAGWLLGNPECDRLLSvPEWS 92
gi 143774065  19 ICIGYLSNNSTDKVDTIIENNVTVTSSVELVETEHTGSFCSIN-----GKQPISLGDCSFAGWILGNPMCDELIGkTSWS 93
gi 119364589  21 ICVGYLSTNSSERVDTLLENGVPVTSSIDLIETNHTGTYCSLN-----GVSPVHLGDCSFEGWIVGNPACTSNFGiREWS 95
gi 122853     29 LCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNN------PHRILDGIDCTLIDALLGDPHCDVFQN-ETWD 101
gi 122916     29 ICLGHHAVENGTSVKTLTDNHVEVVSAKELVETNHTDELCPS------PLKLVDGQDCHLINGALGSPGCDRLQD-TTWD 101
gi 122855     25 ICMGHHSVANGTMVKTLTDDQVEVVTARELVESQTLPELCPS------PLRLVDGQTCDIINGALGSPGCDHLNG-AEWD 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122953     97 SILHEVKPVTSGCFPIMH-DRTKIRQLPNLLRGYEHIRLSTHNvINAETAPGGpykvGTSGSCPNVTNGNgFFATMAWAV 175
gi 122929     94 YIVERPTAQNGICYPGVLnEVEELKALIGSGERVERFEMFPKS-TWTGVDTSS----GVTRACPYNSGSS-FYRNLLWII 167
gi 1346265    95 YIIETSNSENGTCYPGEFiDYEELREQLSSISSFEKFEIFPKAsSWPNHETTK----GVTAACSYSGASS-FYRNLLWIT 169
gi 160332312  94 YIVEKDNPINSLCYPGDFnDYEELKHLLSSTNHFEKIQIIPRS-SWSNHDASS----GVSSACPYIGRSs-FFRNVVWLI 167
gi 122912     93 YIMEKENPRDGLCYPGSFnDYEELKHLLSSVKHFEKVKILPKD-RWTQHTTTG----GSR-ACAVSGNPS-FFRNMVWLT 165
gi 143774065  94 YIVEKPNPTNGICYPGTLeSEEELRLKFSGVLEFNKFEVFTSN-GWGAVNSGV----GVTAACKF-GGSNsFFRNMVWLI 167
gi 119364589  96 YLIEDPAAPHGLCYPGELnNNGELRHLFSGIRSFSRTELIPPT-SWGEVLD------GTTSACRDNTGTNsFYRNLVWFI 168
gi 122853    102 LFVERSKA-FSNCYPYDVpDYASLRSLVASS---GTLEFITEGfTW-TGVTQN----GGSNACKRGPGSg-FFSRLNWLT 171
gi 122916    102 VFIERPTA-VDTCYPFDVpDYQSLRSILASS---GSLEFIAEQfTW-NGVKVD----GSSSACLRGGRNs-FFSRLNWLT 171
gi 122855     98 VFIERPNA-VDTCYPFDVpDYQSLRSILANN---GKFEFIAEEfQW-NTVIQN----GKSSACKRANVNd-FFNRLNWLV 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122953    176 PKndnnkTATNPLTVEVPYICTEGEDQITVWGFHS-DNEAQMVKLYGDSKPQkFTSSANGVTTHYVSQIGGFPNQAedGg 254
gi 122929    168 KT-----KSAAYSVIKGAYNNTGNQPILYFWGVHHpPDTNEQNTLYGSGDRY-VRMGTESMNFAKSPEIAARPAVN--G- 238
gi 1346265   170 K------KGTSYPKLSKSYTNNKGKEVLVLWGVHHpPSVSEQQSLYQNADAY-VSVGSSKYNRRFAPEIAARPEVR--G- 239
gi 160332312 168 KK-----D-NAYPTIKRSYNNTNQEDLLILWGIHHpNDAAEQTKLYQNPTTY-VSVGTSTLNQRSIPEIATRPKVNg--- 237
gi 122912    166 K------EGSDYPVAKGSYNNTSGEQMLIIWGVHHpIDETEQRTLYQNVGTY-VSVGTSTLNKRSTPEIATRPKVN--G- 235
gi 143774065 168 H------QSGTYPVIKRTFNNTKGRDVLIVWGIHHpATLTEHQDLYKKDSSY-VAVGSETYNRRFTPEINTRPRVNg--- 237
gi 119364589 169 K------KNNRYPVISKTYNNTTGRDVLVLWGIHHpVSVDETKTLYVNSDPY-TLVSTKSWSEKYKLETGVRPGYN--G- 238
gi 122853    172 KS------GSTYPVLNVTMPNNDNFDKLYIWGIHHpSTNQEQTSLYVQASGR-VTVSTRRSQQTIIPNIGSRPWVR--G- 241
gi 122916    172 KAt-----NGNYGPINVTKENTGSYVRLYLWGVHHpSSDNEQTDLYKVATGR-VTVSTRSDQISIVPNIGSRPRVR--N- 242
gi 122855    168 KSt-----GNAYPLQNLTKVNNGDYARLYIWGVHHpSTDTEQTNLYKNNPGR-VTVSTKTSQTSVVPNIGSRPLVR--G- 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122953    255 lpQSGRIVVDYMVQKSGKTGTITYQRGILLPQKVWCASGR--S-KVIKGSLPLIGERDCLHEKYGGLNKSKPYYTgEHAK 331
gi 122929    239 --QRGRIDYYWSILKPGETLNVESNGNLIAPWYAFRFVSTsnKgAVFKSNLPIENCDATCQTVAGVLRTNKTFQN-VSPL 315
gi 1346265   240 --QAGRMNYYWTLLDQGDTITFEATGNLIAPWYAFALNKGsdS-GIITSDAPVHNCDTRCQTPHGALNSSLPFQN-VHPI 315
gi 160332312 238 --QSGRMEFFWTILKPNDAINFESNGNFIAPEYAYKIVKKgdS-AIMKSGLAYGNCDTKCQTPVGAINSSMPFHN-IHPH 313
gi 122912    236 --QGGRMEFSWTLLDMWDTINFESTGNLIAPEYGFKISKRgsS-GIMKTEGTLENCETKCQTPLGAINTTLPFHN-VHPL 311
gi 143774065 238 --QAGRMTFYWKIVKPGESITFESNGAFLAPRYAFEIVSVgnG-KLFRSELNIESCSTKCQTEIGGINTNKSFHN-VHRN 313
gi 119364589 239 --QRSWMKIYWSLIHPGEMITFESNGGFLAPRYGYIIEEYgkG-RIFQSRIRMSRCNTKCQTSVGGINTNRTFQN-IDKN 314
gi 122853    242 --LSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTG--KsSIMRSDAPIDTCISECITPNGSIPNDKPFQN-VNKI 316
gi 122916    243 --QSGRISIYWTLVNPGDSIIFNSIGNLIAPRGHYKISKSt-KsTVLKSDKRIGSCTSPCLTDKGSIQSDKPFQN-VSRI 318
gi 122855    239 --QSGRISFYWTIVEPGDLIVFNTIGNLIAPRGHYKLNNQk-KsTILNTPIPIGSCVSKCHTDKGSVSTTNPFQN-ISRI 314
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122953    332 AIGNCPIWVKTP-LKLANGTKYRPPAKllkERGFFGAIAGFLEGGWEGMIAGWHGYTSHGAHGVAVAADLKSTQEAINKI 410
gi 122929    316 WIGECPKYVKSEsLRLATGLRNVPQIE---TRGLFGAIAGFIEGGWTGMIDGWYGYHHENSQGSGYAADRESTQKAVDGI 392
gi 1346265   316 TIGECPKYVKSTkLRMATGLRNVPSIQ---SRGLFGAIAGFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQNAIDGI 392
gi 160332312 314 TIGECPKYVKSDrLVLATGLRNVPQRK---KRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGI 390
gi 122912    312 TIGECPKYVKSEkLVLATGLRNVPQIE---SRGLFGAIAGFIEGGWQGMVDGWYGYHHSNDQGSGYAADKESTQKAFDGI 388
gi 143774065 314 TIGDCPKYVNVKsLKLATGPRNVPAIA---SRGLFGAIAGFIEGGWPGLINGWYGFQHRNEEGTGIAADKESTQKAIDQI 390
gi 119364589 315 ALGDCPKYIKSGqLKLATGLRNVPAIS---NRGLFGAIAGFIEGGWPGLINGWYGFQHQNEQGTGIAADKESTQKAIDQI 391
gi 122853    317 TYGACPKYVKQNtLKLATGMRNVPEKQt---RGLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQI 393
gi 122916    319 AIGNCPKYVKQGsLMLATGMRNIPGKQa---KGLFGAIAGFIENGWQGLIDGWYGFRHQNAEGTGTAADLKSTQAAIDQI 395
gi 122855    315 AIGECPKYVKQGsLKLATGMRNVPEKAs---RGLFGAIAGFIENGWQGLIDGWYGFRHQNAEGTGTAADLKSTQAAIDKI 391
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122953    411 TKNLNSLSELEVKNLQRLSGAMDELHNEILELDEKVDDLRADTISSQIELAVLLSNEGIINSEDEHLLALERKLKKMLGP 490
gi 122929    393 TNKVNSIIDKMNTQFEAVDHEFSNLERRIDNLNKRMEDGFLDVWTYNAELLVLLENERTLDLHDANVKNLYERVKSQLRD 472
gi 1346265   393 TSKVNSVIEKMNTQFTAVGKEFNNLERRIENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVRNLYEKVKSQLRN 472
gi 160332312 391 TNKVNSIIDKMNTQFKAVGKEFNNLERRVENLNKKMEDGFLDVWTYNVELLVLMENERTLDFHDSNVKNLYDKVRLQLKD 470
gi 122912    389 TNKVNSVIEKMNTQFEAVGKEFGNLERRLENLNKRMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRMQLRD 468
gi 143774065 391 TSKVNNIVDRMNTNFESVQHEFSEIEERINQLSKHVDDSVVDIWSYNAQLLVLLENEKTLDLHDSNVRNLHEKVRRMLKD 470
gi 119364589 392 TTKINNIIDKMNGNYDSIRGEFNQVEKRINMLADRIDDAVTDIWSYNAKLLVLLENDKTLDMHDANVKNLHEQVRRELKD 471
gi 122853    394 NGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRE 473
gi 122916    396 NGKLNRLIEKTNEKYHQIEKEFEQVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDVTDSEMNKLFERVRRQLRE 475
gi 122855    392 NGKLNRLIEKTNEKYHQIEKEFNKIEGRVQDLEKYVEDTKIDLWSYNAELLVALENQHTIDVTDSEMNKLFERVRRQLRE 471
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122953    491 SAVDIGNGCFETKHKCNQTCLDRIAAGTFNAGEFSLPTFDSLNITAASLNDDGLdNHTILLYYSTAASSLAVTLMIAIFI 570
gi 122929    473 NAMILGNGCFEFWHKCDDECMESVKNGTYDYPKYQDESKLNRQEIESVKLESLG-VYQILAIYSTVSSSLVLVGLIIAVG 551
gi 1346265   473 NAKEIGNGCFEFYHKCDDECMESVKNGTYDYPKYSEESKLNREEIDGVKLESMG-VYQILAIYSTVASSLVLLVSWGAIS 551
gi 160332312 471 NARELGNGCFEFYHKCDNECMESVRNGTYDYPQYSEEARLNREEISGVKLESMG-VYQILSIYSTVASSLALAIMIAGLS 549
gi 122912    469 NVKELGNGCFEFYHKCDDECMNSVKNGTYDYPKYEEESKLNRNEIKGVKLSSMG-VYQILAIYATVAGSLSLAIMMAGIS 547
gi 143774065 471 NAKDEGNGCFTFYHKCDNKCIERVRNGTYDHKEFEEESKINRQEIEGVKLDSSGnVYKILSIYSCIASSLVLAALIMGFM 550
gi 119364589 472 NAIDEGNGCFELLHKCNDSCMETIRNGTYDHTEYAEESKLKRQEIDGIKLKSEDnVYKALSIYSCIASSVVLVGLILSFI 551
gi 122853    474 NAEEMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVELKSGY--KDWILWISFAISCFLLCVVLLGFI 551
gi 122916    476 NAEDQGNGCFEIFHQCDNNCIESIRNGTYDHNIYRDEAINNRIKINPVTLTMGY--KDIILWISFSMSCFVFVALILGFV 553
gi 122855    472 NAEDQGNGCFEIFHKCDNNCIESIRNGTYDHDIYRDEAINNRFQIQGVKLIQGY--KDIILWISFSISCFLLVALLLAFI 549
                        570
                 ....*....|....*
gi 122953    571 VYMVSRDNVSCSICL 585
gi 122929    552 LWMCSNGSMQCRICI 566
gi 1346265   552 FWMCSNGSLQCRICI 566
gi 160332312 550 FWMCSNGSLQCRICI 564
gi 122912    548 FWMCSNGSLQCRICI 562
gi 143774065 551 FWACSNGSCRCTICI 565
gi 119364589 552 MWACSSGNCRFNVCI 566
gi 122853    552 MWACQRGNIRCNICI 566
gi 122916    554 LWACQNGNIRCQICI 568
gi 122855    550 LWACQNGNIRCQICI 564
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap