Conserved Protein Domain Family
7tm_1

?
pfam00001: 7tm_1 
Click on image for an interactive view with Cn3D
7 transmembrane receptor (rhodopsin family)
This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.
Statistics
?
PSSM-Id: 249497
View PSSM: pfam00001
Aligned: 67 rows
Threshold Bit Score: 106.234
Threshold Setting Gi: 229463010
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam00001 is classified as a model that may span more than one domain.
pfam00001 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZIY_A        56 YLFTKTKSLQ-TPANMFIINLAFSDFTFSLVNGFPLMTISCFL-KkWIFGFAACKVYGFIGGIFGFMSIMTMAMISIDRY 133
gi 112806     97 MAVSLEKKLQ-NATNYFLMSLAIADMLLGFLVMPVSMLTILYGyR-WPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRY 174
gi 1168221    49 VLICTQPALR-NTSNFFLVSLFTSDLMVGLVVMPPAMLNALYG-R-WVLARGLCLLWTAFDVMCCSASILNLCLISLDRY 125
gi 341940155  63 ATILKVRTFH-RVPHNLVASMAISDVLVAVLVMPLSLVHELSGrR-WQLGRRLCQLWIACDVLCCTASIWNVTAIALDRY 140
gi 8488960   104 ISVCFVKKLR-QPSNYLIVSLALADLSVAVAVMPFVSVTDLIGgK-WIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRY 181
gi 112805    185 IAVCMVRKLR-RPCNYLLVSLALSDLCVALLVMPMALLYEVLe-K-WNFGPLLCDIWVSFDVLCCTASILNLCAISVDRY 261
gi 123119     41 LAVGLNRRLR-SLTNCFIVSLAITDLLLGLLVLPFSAFYQLSc-R-WSFGKVFCNIYTSLDVMLCTASILNLFMISLDRY 117
gi 48429211   81 VAIAKTPRLQ-TLTNLFIMSLASADLVMGLLVVPFGATIVVWg-R-WEYGSFFCELWTSVDVLCVTASIETLCVIALDRY 157
gi 118228     46 AAVIRFRHLRsKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAG-F-WPFG-SFCNIWVAFDIMCSTASILNLCVISVDRY 122
gi 1168243   119 LSVACNRHLQ-TVTNYFIVNLAVADLLLSATVLPFSATMEVLG-F-WAFGRAFCDVWAAVDVLCCTASILSLCTISVDRY 195
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZIY_A       134 NVIGRPMAASKKMShRRAFIMIIFVWLWSVLWAIGPiFGwGAYTLE-Gv--LCNCSFDYISrDStt-----rSNILCMFI 205
gi 112806    175 VAIQNPIHHSRFNSrTKAFLKIIAVWTISVGVSMPIpVFgLQDDSKvFk--QGSCLLADDN-F-----------VLIGSF 240
gi 1168221   126 LLILSPLRYKLRMTaPRALALILGAWSLAALASFLPlLLgWHELGKaRtpaPGQCRLLASL-P----------FVLVASG 194
gi 341940155 141 WSITRHLEYTLRTRkRVSNVMILLTWALSTVISLAPlLFgWGETYSeP---SEECQVSREP-S----------YTVFSTV 206
gi 8488960   182 LGITRPLTYPVRQNgKCMAKMILSVWLLSASITLPP-LFgWAQNVNdDk----VCLISQDF-G----------YTIYSTA 245
gi 112805    262 LAITKPLEYGVKRTpRRMMLCVGIVWLAAACISLPP-LLiLGNEHEdEe-gQPICTVCQNF-A----------YQIYATL 328
gi 123119    118 CAVTDPLRYPVLITpVRVAVSLVLIWVISITLSFLSiHLgWNSRNEtSs-fNHTIPKCKVQ-VNl-------VYGLVDGL 188
gi 48429211  158 LAITSPFRYQSLLTrARARGLVCTVWAISALVSFLPiLMhWWRAESdE---ARRCYNDPKC-CDfvt---nrAYAIASSV 230
gi 118228    123 WAISSPFRYERKMTpKAAFILISVAWTLSVLISFIPvQLsWHKAKPtSp-sDGNATSLAET-IDncdsslsrTYAISSSV 200
gi 1168243   196 VGVRHSLKYPAIMTeRKAAAILALLWVVALVVSVGP-LLgWKEPVPpD---ERFCGITEEA-G----------YAVFSSV 260
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZIY_A       206 LGFFGPILIIFFCYFNIVMSVSNHEKEMAAmakrln-------------------------------------------- 241
gi 112806    241 VAFFIPLTIMVITYFLTIKSLQKEATLCVSdlstraklasfsflpqssls------------------------------ 290
gi 1168221   195 VTFFLPSGAICFTYCRILLAARKQAVQVASlttgtagqaletlqvp---------------------------------- 240
gi 341940155 207 GAFYLPLCVVLFVYWKIYRAAKFRMGSRKTnsvspvpeavevknatqh-------------------------------- 254
gi 8488960   246 VAFYIPMSVMLFMYYQIYKAARKSAAKHKFpgfprvepdsvialngivkl------------------------------ 295
gi 112805    329 GSFYIPLSVMLFVYYQIFRAARRIVLEEKRaqthlqqalngtgspsapqapplghtelassgngqrhssvgntsltystc 408
gi 123119    189 VTFYLPLLVMCITYYRIFKIARDQAKRIHHmg------------------------------------------------ 220
gi 48429211  231 VSFYVPLCIMAFVYLRVFREAQKQVKKIDScerrflggparppspspspvpapapp------------------------ 286
gi 118228    201 ISFYIPVAIMIVTYTRIYRIAQKQIRRIAAleraavhakncqttt----------------------------------- 245
gi 1168243   261 CSFYLPMAVIVVMYCRVYVVARSTTRSLEAgvkrergkasevvlrihcrgaat--------------------------- 313
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZIY_A       242 ---------------------------akelrkAQAGANAEMRLAKISIVIVSQFLLSWSPYAVVALLAQFGPLEw---- 290
gi 112806    291 -------------seklfqrsihrepgsytgrrTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKEScn--e 355
gi 1168221   241 ------------------rtprpgmesadsrrlATKHSRKALKASLTLGILLGMFFVTWLPFFVANIAQAVCDCIs---- 298
gi 341940155 255 ---------------pqmvftvrhatvtfqtegDTWREQKEQRAALMVGILIGVFVLCWFPFFVTELISPLCSWD----- 314
gi 8488960   296 --------------qkeveecanlsrllkherkNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTscs-- 359
gi 112805    409 gglssgggalaghgsgggvsgstgllgsphhkkLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFETMHv---- 484
gi 123119    221 --------------------------------sWKAATIGEHKATVTLAAVMGAFIICWFPYFTVFVYRGLKGDDa---- 264
gi 48429211  287 --------pgpprpaaaaataplangragkrrpSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHREL----- 353
gi 118228    246 -------------------gngkpvecsqpessFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGSGetqpf 306
gi 1168243   314 -----------gadgahgmrsakghtfrsslsvRLLKFSREKKAAKTLAIVVGVFVLCWFPFFFVLPLGSLFPQLk---- 378
                        330       340
                 ....*....|....*....|....*
2ZIY_A       291 -VTPYAAQLPVMFAKASAIHNPMIY 314
gi 112806    356 hVIGALLNVFVWIGYLSSAVNPLVY 380
gi 1168221   299 ---PGLFDVLTWLGYCNSTMNPIIY 320
gi 341940155 315 -VPAIWKSIFLWLGYSNSFFNPLIY 338
gi 8488960   360 ciPLWVERTFLWLGYANSLINPFIY 384
gi 112805    485 --PASLSSLFLWLGYANSLLNPIIY 507
gi 123119    265 -INEAFEAVVLWLGYANSALNPILY 288
gi 48429211  354 -VPDRLFVFFNWLGYANSAFNPIIY 377
gi 118228    307 cIDSNTFDVFVWFGWANSSLNPIIY 331
gi 1168243   379 -PSEGVFKVIFWLGYFNSCVNPLIY 402
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap
Click on image for an interactive view with Cn3D