Conserved Protein Domain Family
PTZ00014

?
PTZ00014: PTZ00014 
myosin-A; Provisional
Statistics
?
PSSM-Id: 240229
View PSSM: PTZ00014
Aligned: 16 rows
Threshold Bit Score: 1201
Threshold Setting Gi: 124505993
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

PTZ00014 is classified as a model that may span more than one domain.
PTZ00014 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156083030    7 DEIATANALKRQGTAVQAFDASDNllTGFQIWTDAAPSIKEDPSLLFVKCLVHPGSTREKLICSQIEPappagqeDKTFE 86
gi 66363150     1 MSAKDVKGLTRKVSGKFVFDAKTA--KGSTVWCDSAPSVLNDPDSLFAKCIVQAGSTAEKLCLKEVDS-------NATFE 71
gi 71032757     7 EKLQTANALKRATSNLAVFDSNGNvlGGIYVWSDLAPAVKENPELMFAKCLVHPGSTTEKLICSQVEPpndqvssKQKFE 86
gi 84999098     7 EKIQTANALKRATSNLAVFDSNGNvlNGVYVWSDLAPAVRENPELMFAKCLVHPGSTTERLVCTQVEPp-----nDEKFE 81
gi 209879237    1 MSARDVKGLTRKASGKFVFDAKTA--KGTEVWCDSAPSVKDDPDSLFAKCVVLADSTASLLKLKESDS-------SVIFE 71
gi 156094348    2 NKASELSNYFRINSEL--VNKIENdiEKFYVWTYKSPNVDRYPDLVFFKCLVL-SVDGDNYRVKEICPe-----tNSEYV 73
gi 237831101   15 AKDSPEVKHFQRKSSVVPFGRDGRaaTNFTCWTADCPAVKADPTLVFAKCIVVGGSMDTQLELEQVDPp-----aRGTFT 89
gi 237832241    7 QDCKTAAALIRAGSLIEGVESAG---KDFLVWTTQGPAVKKDPDLLFSLCRVLPGSTQQTLKLQQVEPta----dSQELT 79
gi 237834595   15 PASAHGDKLRRGRTEV---DPKADtlQGMKIWTNNAPAVHANADECFALCLILPESSETVLHLKQIDPppd-tteAESFT 90
gi 221057285    2 NKASELSNYFRINSEF--VNKIENeiEKFYVWTYKSPNADRYPDVVFFKCLVL-SVDGDNYRVKEISPe-----tNSEYV 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156083030   87 VPLANAWNTNMSIDPMTYGDIGMLPQTNIPCVLDYLRHRFMNNQIYSTADPLLVAINPFKDLGNATDAVIREYKTAADSL 166
gi 66363150    72 AKIDSCFIANEPFDPNTYPDIGLVPYTSIPCVLDFLKQRYLVNQIYTTADPLLVAINPFKDVGLVGNDVILNYRDANDVS 151
gi 71032757    87 VPLANAWNTNSQIDPMTYGDIGMLPQTSIPCVLDYLRHRFHKNQIYSTADPLMVSINPFKDLGNSGQDVIDRYKSAKSLM 166
gi 84999098    82 VPLTNAWNTNSQIDPMTYGDIGMLPQTSIPCVLDFLRHRFYKNQIYSTADPLMVSINPFKDLGNSGQDVIERYKRAKNLL 161
gi 209879237   72 AKPDTCYLANEPFDPNSYSDIGLVPYTSIPCVLDFLKQRYMVNQIYTTADPLLVAINPFKDVGLVTNEKVLQYRDIDDVS 151
gi 156094348   74 VKKEHLFNCNNMVNVNSHR-LNDMLHQNSAEVLNTLAMRYEKNFIYTIAEPMLISINPYQIIDVNMEDY-----KTRNSD 147
gi 237831101   90 VAPTDVFNANELIEPETVDDIGYLPHTNVACVLDVLKSRFLRSIIYTTAEPLLVAINPFKDLGNTTDAWISTYRNASKPE 169
gi 237832241   80 VQAKEVWQANPGIDPLTYGDIGGLPHTNEPCVLDFLARRYQSKVIYTTAEPLIVAVNPFQDLKNAGPDTIALYRDAPDVD 159
gi 237834595   91 IDPEDAFNANIGIEVDKFPDIGLLPHKNCAAVLDFLKQRYLLDLIYTTADPLLIAINPFKDLNNTTPEWLQLYRDAPDAE 170
gi 221057285   74 VKKEHLFNCNNMVNVNSHR-LNDMVHQNSAEVLNTLAMRYEQNFIYTIAEPMLISINPYQIIDVNIDDY-----KTRNSD 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156083030  167 KLAPHVFRTARMALENVYDYKYSQTIIVSGESGAGKTEATKQMMRYFAYSQKGETS-GKIQTAIMAANPVLEAFGNAKTI 245
gi 66363150   152 KLPPHVFAIAKRAFDNIMSVSRCQSILVCGESGAGKTEATKHVMKFFASSKSGTMD-LKIQNAIMAANPVLEAFGNAKTT 230
gi 71032757   167 DMPPHVYYTSRRALENLHDYKYSQTIIVSGESGAGKTQSANMMMRYFASGSGLNKG-SHIQQVVMAFNPVLESFGNAKTI 245
gi 84999098   162 DMPPHVYYTSRRALENLHDYKYSQTIIVSGESGAGKTQSANMMMRYFASGSGFTGG-SHIQQVVMAFNPVLESFGNAKTI 240
gi 209879237  152 KLPPHVFAIAKRALDNLVTVARCQSILVCGESGAGKTEATKHIMKFFASSKSGNLD-LKIQNAIMAANPVLEAFGNAKTI 230
gi 156094348  148 ELPPHVYTYAKDAMLDFINTKNCQSIIISGESGSGKTEASKLVIKFYLSGVKQDNS---ISKTLWDSNFILEAFGNAKTI 224
gi 237831101  170 MLPPHVFKTARAALEDLEGYKKNQSIIVSGESGAGKTEATKQIMRFFASASSEVRT--TIQDTIMAGNPILEAFGNAKTI 247
gi 237832241  160 KLPPHVFYASRRAMTNMHQLKKPQTIIVSGESGAGKTETTKMLMKYLATSAGGNLD-LKIQTAIMAANPVLEAFGNAKTV 238
gi 237834595  171 ILAPHVFRLARTVLERLSAFMASQTIIVSGESGAGKTEATKQIMSYFAAGKRGEVShQRIQNAVIAANPVLEAFGNAKTV 250
gi 221057285  148 ELPPHVYTYAKDAMLDFINTRNSQSIIISGESGSGKTEASKLIIKFYLSGVKRDNN---ISKTLWDSNFILEAFGNAKTI 224
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156083030  246 RNNNSSRFGRFMQLDVSEEGGIRYGSVVAFLLEKSRIITQDSDERSYHIFYQFLKGAT--PEMRNKYKLKGLNEYKFLN- 322
gi 66363150   231 RNNNSSRFGRFMQLQLGKMGGIEYGVVRNFLLEKSRVITQESLERSYHIFYQLIKGAEtiPGLKEKLKLKSLNEYKFIN- 309
gi 71032757   246 RNNNSSRFGRFMQLDVAPEGGIRYGSIVTFLLEKSRLVTQDDDERSYHIFYQLLKGAN--DQLRSKLKLKRINEYAYLN- 322
gi 84999098   241 RNNNSSRFGRFMQLDVAAEGGIRYGSIVTFLLEKSRIVTQDDDERSYHIFYQLLKGAN--DQLRSKLKLKRIGEYEYLN- 317
gi 209879237  231 RNNNSSRFGRFMQLQLGRMGGIEYGTVLNFLLEKSRVVTQEESERSYHIFYQILKGADavPGLKEKLKLKGLTEYKFIN- 309
gi 156094348  225 KNNNSSRYGKYIKIQLDENQNIVSSCIEIFLLEKIRVVSQEQEERCYHIFYEILQGMS--SEMKRKYNIKSETEYKYIS- 301
gi 237831101  248 RNNNSSRFGRFMMLDVSSHRGIQHGSISNFLLEKVRVVSQEANERSYHIFYQLLKGAT--SEMRAKYHLRSLKEYAYLNg 325
gi 237832241  239 RNNNSSRFGRFMLLDVAREGGIQHGKVVAFLLEKSRIVCQDKDERSYHIFYQFLKGAP--GHMRQRYMLQPLEAYTFIN- 315
gi 237834595  251 RNNNSSRFGRFMQLQLGEKGGIEYGSIRNFLLEKVRVTSQEQHERSYHIFYQLVKGAD--DAKRRQLHLLNLEDYTYLS- 327
gi 221057285  225 KNNNSSRYGKYIKIQLDENQNIVSSCIEIFLLEKIRVVSQEQEERCYHIFYEILQGMS--NEMKKKYNIKSESEYKYIS- 301
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156083030  323 PN--CLDVPSIDDVADFKEVLESFKNMGLGESEIDTILSVLSGVLLMGNVEIGATSVDGIDDAAMIVNKD--VFNTACNL 398
gi 66363150   310 PE--CLDVETIDDVQDFKDVMQSFKTMGLSDSQIEDILSLVSGILLLGNVEIEPEDVGGGVEGSRIADSSreSFNNAMEL 387
gi 71032757   323 SK--CTEVNGVDDAKEFGLILNSFERMKLSEDQKETVLSLLSGVLLLGNVEVSGEERDGLTDAAVITNES--LLRDCAQL 398
gi 84999098   318 DK--CTEVNGVDDAKDFGLILNSFDQMKLTEEQKETVLSLLSGVLLLGNVQISGEEREGLTDASVITNES--LLRDCAEL 393
gi 209879237  310 PK--CLDVDNIDDVSDFKDVITSFKTMGLSESQIEDILSVVSGVMLLGNVEIESEDVGGGVEGAKIGESSkeIFNDAMEL 387
gi 156094348  302 NK--SVTIPEIDDAKDFENLMTSMDKMNMSSLK-DDLFLTLSGIMLLGNIEFNEIEKGGKTNCSELSEENlkVVQETSDL 378
gi 237831101  326 KNggCYDVPGIDDKADFEEVLQSLDAMQITGSKRHSVFSILSGLLLIGNVSIEGKDAQGVPDAAYISPQSeeILEEACQL 405
gi 237832241  316 PH--CLDAPGIVDTEDFEQTVKSLESMNMTETETCTIWSIVSGVLLMGNAKPTGKTEAGVENAACFVGESeaALRNACSL 393
gi 237834595  328 KNggCYDCPGIDDVKDFKEMNKSLRSIGLNLDDVESLWSIIAGVLLLGNVHLESRETDGQPNAAALTPDGeaTLQKCCAL 407
gi 221057285  302 NK--SITIPEIDDAKDFENLMASMDKMNMSTLK-DDLFLTLSGILLLGNIEFNEIEKGGKTNCSELSEGNlkVVQETSDL 378
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156083030  399 LYLDPALLETELTVKITSAGNNQIKGPRKKQDGEVLKTSVCKAIYERLFLWLIRNLNRSIEPPTG-FKTFIGMLDIFGFE 477
gi 66363150   388 CKLDKEIVEKELIVKISYAGKNVIEGRFRPDETRMLKDSLAKGLYDKLFDYIILNLNENIKPPSG-FKVFCGMLDIFGFE 466
gi 71032757   399 LYLDYDQLKYDLTMKKTMVGGGEIVSPRRKDESEVLKKSLSKAVYNKLFLWLVATVNKTIAPPEP-FKYFIGLLDIFGFE 477
gi 84999098   394 LYLDYDQLKYDLTMKKTMVGGGEIVSPRRKDESEVLKKSLSKAVYNKLFFWLVATVNKTIAPPEP-FKYFIGLLDIFGFE 472
gi 209879237  388 CKLDPASIEKELIVKITTAGKNIIEGRFRADESRMLKDSLAKGLYDKLFDYIILNLNKTIMPPQG-FNIFCGMLDIFGFE 466
gi 156094348  379 LGIDYVSLSNSLTFTEKNIAKQRIEIPLSVEESLSICRSISKDIYNKIFEHITKKINEFLNNNKE-LDRYIGILDIFGFE 457
gi 237831101  406 LSVDDAALKKEILVKSTKVGPQVIEGVRTKDEAKTSVLSLSKNVYDKLFDWLVRQLNSLIDAPDG-MPNFIGILDIFGFE 484
gi 237832241  394 LFLDYPSILHELTVKTTYAGSNKIESRWTVPDSEMLRASLAKGMYEQLFLWIIRKLNADIEPKGGsFDVFMGLLDIFGFE 473
gi 237834595  408 LFVDEEAVKKEILYKVKTIGDQQIESPNSLSDALMNRDSLAKAVYEKLFDWVVRRVNATIEPPQG-FGIFMGMLDIFGFE 486
gi 221057285  379 LGIDYVSLSNNLTFTEKNIANQRIEIPLSVEESLSICRSISKDIYNKIFEHMTMKINAFLNNNKE-LDKYIGILDIFGFE 457
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156083030  478 VFKNNSLEQLFINITNEMLQTNFVDIVFKREAALYTNEGIPIPELKYTSNADIIEVLCSKGKSILSLLEDQCLAPGGTDE 557
gi 66363150   467 VFKNNSLEQFFINVTNEYLQKNFTDIVFEKEQNLYSSEGISAANLEFKSNKMVLEALCDKKNSILSAMEDQCLVPNGSDE 546
gi 71032757   478 VFKNNSLEQLFINITNEMLQTNFVNIVFKREAQLYADEGIASPKLEYESNSLVIELLCGKTKSILSVLEDQCLAPGGNDM 557
gi 84999098   473 VFKNNSLEQLFINITNEMLQTNFVNIVFKREAQLYADEGIACPNLEYESNSLVIDVLCGKTKSVLSILEDQCLAPGGNDA 552
gi 209879237  467 VFKNNSLEQFFINVTNEYLQKNFTDVVFEKEQKLYNDEGISTANIEFKSNKQVLEVLCDKKNSILSALEDQCLVPNGSDE 546
gi 156094348  458 IFLKNSLEQLLINIANEEIHNIYLYVVYEKESNLYKSEGIIAESVKYTTNESIIDLLRGK-TSVISILEDSCLAPGKKDE 536
gi 237831101  485 VLEVNSLEQVLINITNEYLQKHFIDVVFDMETKLYQAEGVPTEALEYTDNLALVGALCGKNDSFFALLEDACLGIRSTDE 564
gi 237832241  474 VFQNNSLEQLFINITNEVLQRNFTDIVFEKELQLYSKEGISSKKIEYTTNEKLIETLLGKGTSVLAALEDQCISPSGTDE 553
gi 237834595  487 MFENNSLEQLLINITNEQLQKNFIQIVFARETKLYYEEGIGNVKITWTDNENVIKALCGKSSSVLAILEDKSLAPGGTDE 566
gi 221057285  458 IFLKNSLEQLLINIANEEIHNIYLYVVYEKESNLYKSEGIIAESVKYTTNESIIDLLRGK-TSVISILEDACLAPGKKDE 536
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156083030  558 NLVSSCNNQLKDNSKYSPAKVGAKLNFTVTHTIGTISYNAQSFIFKNKDVLTAELVECVNASPNEMIKGLFENVVVTRGK 637
gi 66363150   547 KFLSAAYTNLKSNPCLKPAKIGGDVNFIVSHTIGDIQYCASGFLFKNKDVLRAELVEVVQKSSNKLVADLFKDVFVERGK 626
gi 71032757   558 NLTSTCNTQLSNNPKYVKSK--QDKYFLVVHTIGPIQYCSDGFINKNKDLLTGELVKLVNASQNPLVSELFKGDEVVSGK 635
gi 84999098   553 NLTSTCNTQLSNNPKYVKSR--QDKYFLIVHTIGPIQYCSDGFVTKNKDLLTGELVKLVNSSNNPLVSELFMGDEVVSGK 630
gi 209879237  547 KFLSAAYSNLKNNDSLKPAKISGEKNFIVSHTIGDIQYCAEGFLFKNKDVLRAELVEVVQKSPNQLVADLFKGIVVERGK 626
gi 156094348  537 SIVGVYTNKFAKHPQYATCKRDMNGSFVIKHTVSDVTYSISNFISKNKDILSPNILRMLQVSKNDLVRSMYEDVEVTES- 615
gi 237831101  565 GFCGTILRRLEPSGFFLESRRDKRLKFIIRHTIADIEYTCEGMLEKNKDFLRKEVMDVMKASTDPVTKALFEGIEIEAGK 644
gi 237832241  554 KFVSSLASKLAGNKCFIPSKNTKSLEFTVVHTIGKVIYNADGFAFKNKDVLRPEIIEITRASTNDVVRGLFEGVKVEKGK 633
gi 237834595  567 AIVTSMNQALKSSDVWKPGQKNPRICFCICHTIADIQYDATGFIEKNKDLLKPELCSIVQASSNNVAKELFEGVVMQKGK 646
gi 221057285  537 SIVGVYTNKFAKHPQYLTCKRDMNGSFVIKHTVSDVTYSISNFISKNKDILSPNVLRMLKVSRNNLVRSMYEDVEATDS- 615
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156083030  638 LAKGQLIGSQFMSQLDALMKLINSTDSHFIRCVKPNESKQPLDFNSVKILVQLHALSIIEALQLRKLGYSYRRPYESFLE 717
gi 66363150   627 MAKGQLIGSQFMNSLGSLMSIVNETEPHFIRCVKPNESKKPLDWLASKVLIQLHSLSILEALQLRNLGFSYRRTFSEFIY 706
gi 71032757   636 LAKGMLIGSQFMSQLDSLMALINSTDSHFIRCISPNDKMMPMTWNSVRVLLQLHALSVIEALQLRKLGFSYRRTFAQFNE 715
gi 84999098   631 LAKGMLIGSQFMNQLDSLMTLINSTDPHFIRCISPNDKMMPMTWNSVRVILQLHALSVIEALQLRKLGFSYRRTFAQFND 710
gi 209879237  627 IAKGQLIGNQFMNSLNSLMEIVDQTEPHFIRCVKPNESKKPLDWVASKVLIQLHSLSILEALQLRNLGYSYRRLFSEFIY 706
gi 156094348  616 LGKKNLITFKYLENLQKISSYLKNTNIYFIKCIKPNENKQKNNFNQRKVFPQLFSLSIVETLNIKYF-FQYKYTFSSFLS 694
gi 237831101  645 IGKGTLIASRFLKNLEEMIGIVAQTEAHFIRCLKPNEEKKPLGWNGSKVLNQLFSLSILEALQLRQVGYAYRRNFSEFCS 724
gi 237832241  634 MAKGMLIGSQFMTQLKGLMEVIQKTESHFIRCIKPNDDKVPLKWVNSKVLIQLHALSILEALHLRQLAFSYRRTFEEFAA 713
gi 237834595  647 IAKGQLIASQFMRSLDALLTLISSTESHFIRCLKPNETKNPHDWSNGKVLAQLFSLSILEALQLKNLSFSYRRPYADFLK 726
gi 221057285  616 LGRKNLITFKYLENLKKISSYLKNTNIYFIKCIKPNENKEKNNFNQRKVFPQLFSLSIIETLNIKYF-FQYKYTFASFLS 694
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156083030  718 QYKYLDLSITNDKSLDPKVAAERLITSVGVSKDQYAFGKSMMFLTQKLAKELTAIQRQRLSVWEPITAMIDAWITRQMAK 797
gi 66363150   707 QFKYCDMSAANDKKTDPKILAEKMLSGTNIPKNSWAIGKTMVFLSKDAAKRMAQLQREKLAAFEPLVQLLEAVYLRYKLR 786
gi 71032757   716 QYAYLNLAVVKDSRLSDKDKAIKLVTEVGLGNSDYAVGKTRMFLTRKAANKLTSIVRERLAKWAPLADLLEALLLRLQNQ 795
gi 84999098   711 QYAYLNLAVVKDSRLSDKDKAIKLVTESGLGTSDYAVGKTRMFLTRKAANHLTSIVRERLAKWAPLADLLEALLRRLQYQ 790
gi 209879237  707 QFKYCDLSIANDKETDPSILAQRMLEICEIPKKEWAVGKTMVFLTKNAAKTMAHKQREKLAAFEPLVQLLEAVYLRYKLR 786
gi 156094348  695 YYQYLDLPTSNDSSLDDKGKVSKMLQR-NFGDDSYKIGNTMVFLKKDAIHTIREIISNNLKSYKNLCSITSALITKIKKR 773
gi 237831101  725 HFRWLDLGLVNSDR-DRKEVAQLLLEQSGIPESSWVIGKTMVFVKPDAAKELSILQREKLMCFQPLIGVLGPMWRKVLLR 803
gi 237832241  714 QFRFINLGVSNKPGADAKTICVELLKSTSISADEYALGKTMVFLKPQAAKMLVRLQREALSAWEPLVGVFEGMTVLKRAK 793
gi 237834595  727 QFEQLDLEVTRKSG-NAKEKTKQLLTRANVPQAKWALGNTMVFMKPDAVRELTQKMRLIVVAWEPLIRVLEACHSRALKM 805
gi 221057285  695 YYQYLDLPISNDNTLDDRSKVSKMLER-NFSDDSYKIGNTMVFLKKDAIHTIREIIYNNLRSYRNLCNITSALITKIKKK 773
                         810       820
                  ....*....|....*....|....*....
gi 156083030  798 KSLMSA-VEDIVRLQAHLRRHIVESRVTP 825
gi 66363150   787 REFRKNqLKPLVRIQAQLRRVLDIEISVM 815
gi 71032757   796 RELKKS-VKSIVRLQAHLRRVLNEGERPA 823
gi 84999098   791 RELKKT-VKSIVRLQAHLRRVLNEGERPA 818
gi 209879237  787 KNFIKYqLKPLTRIQAQLRRVLDIEIAVN 815
gi 156094348  774 TTVGEN-INHLQLAQAYFRKHKYIAQLK- 800
gi 237831101  804 KKMARV-IHFLTRLESNARRHLEPDSINI 831
gi 237832241  794 QLSTGR-AVPATRICANVRRKLVQAGIKV 821
gi 237834595  806 RAIRDS-VQWVVRIQSQIRKARVIME--- 830
gi 221057285  774 TTVEEN-IKHLQIAQAYFRKHKYIAQLK- 800
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap