NCBI CDD Logo
?
PRK14507: PRK14507 
putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional
Statistics
?
PSSM-Id: 237737
View PSSM: PRK14507
Aligned: 15 rows
Threshold Bit Score: 2489.57
Threshold Setting Gi: 170748018
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PRK14507 is classified as a model that may span more than one domain.
PRK14507 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380    26 GGEARTGLDALCVYLGVALEYEDAWGRRTVVPEAKKRDIVAALGYPVAD---QAEAEACLADLRAAArRRILPPLLVVQG 102
gi 218530889    7 SASNVSDLERLADLVGIADGFTDAFGKRVDTPLDVRRGMLEALGFAAGD---DEAIRRSLDAVEAVR-ANVIPPLLAAEA 82
gi 188582078   11 SASDVTALERLADLVGIADGFTDAFGQRVDTSLEVRRGMLEALGFSAGD---DDAIRRSLAAVETVR-ANVIPPLLAAEA 86
gi 163852130    7 SASNVSDLERLADLIGIADGFTDAFGKRVDTPLDVRRGMLEALGFAAAD---DEAIRRSLAAVEAVR-ANVIPPLLAAEA 82
gi 89900940     6 TEHNAQPLNQLCAHFGIATDYDDIWGTRHPVAHASLLALLSDFGVTLAD---ESDTPDALDAVLRCAwRQALPPVVTIQA 82
gi 74317192     1 ---MSTLLDQACERCGILPEYYDIWGGAHPTSEAAKRALLEAMGVPAAS---DADLARSLDELERREwSRALPPVVVVRE 74
gi 82702531     1 ---MSNPLDQLCELYGVLPCYSDIWGNTRYTSQDAKRALLGAMGVAAAT---EEEISASLHIFIRRKwEHVLPPVQVVRE 74
gi 119898090    1 --MSDSAIEALCGHLGIDLAYEDAWGRRHEVDEDTRRALLAALGHPLEEgraEQHAACELERLREVAaARVLPPLLVLEG 78
gi 240139460    2 SASNVSDLERLADLVGIADGFTDAFGKRVDTPLDVRRGMLEALGFAAAG---DEAIRRSLDAVEAVR-ANVIPPLLAAEA 77
gi 239814986    1 ------MLERLCRHYGISPAYHDAFGTLRHASPENLAALLAEFGVQAGA---ATGAEAD---------APAMPPVQVVQA 62
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380   103 gtpplRLAANLPVE--FIGRTLPWRIVLEDGGERSGVVVPRPASADTPLPDSaspdsaspdaplpeadgsgddsrrpall 180
gi 218530889   83 -----RRGVRVPVRmgVTSGAVAWRLVDEHERSREGRATLTASEDGTGFDLP---------------------------- 129
gi 188582078   87 -----RRGLRVPVRmgVTSGAVAWRLVDEHDRSREGRATLTASEAGAGFDLP---------------------------- 133
gi 163852130   83 -----RRGVRVPVRmgVTSGAVAWRLVDEHERSREGRATLTASEEGAGFDLP---------------------------- 129
gi 89900940    83 sapawDVSLRLPAS----LTHIRWQLRDETGTLHQGEVAADALPEIARTELDgvawcer-------------------ql 139
gi 74317192    75 perpyRVPLVVAEA--DLGAGRRWKLRQESGGEIAGEFSPAALEEVARVTFDgvaytrr-------------------tl 133
gi 82702531    75 wmrpyRIAVALPAL--EGKGRYRWRLCRESGTEDHDEFIPDALEEVERYRFTapgnfgsfddpge-------qefvrril 145
gi 119898090   79 vaaplVLHPRLPAA--LVGQTLWWRIALEGGGERRGRVAARTREGAGEAAAEgervea--------------------el 136
gi 240139460   78 -----RRGVRVPVRmgVTSGAVAWRLVDEHERSREGRATLTASEDGTGFDLP---------------------------- 124
gi 239814986   63 ha--pHWSLQLPQR----SGSLRWRLRDEQGLVREGEADAQPWPHGSctlq----------------------------- 107
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380   181 elpiDVPPGHHRLRLfepaQPPRELATAALAICPATCFQLPRPAPqclGDRLWGPAVQVYALRSSRNWGIGDFGDLLRLV 260
gi 218530889  130 ----PLTPGYHRLTV----TVGDSRAQAWIVSAPQRCWRPRAYAEd--GARDWGLAAQLYGLRSPSNLGIGTYADAGRAA 199
gi 188582078  134 ----PLTPGYHQLTI----TVGDRRAMAWIVSAPQKCWRPRAYAEd--GARDWGLAAQLYGLRSPANLGIGTYADAGRAA 203
gi 163852130  130 ----PLTPGYHRLTV----TVGDSRSQAWIVAAPQRCWRPRAYAEd--GARDWGLAAQLYGLRSPSNLGIGTYADAGRAA 199
gi 89900940   140 sfslRLAAGYHRLSV------ADLAGETLVISAPERCYRPAALQN---GGKVWGPTVQLYALRSRRNWGIGDFSDLAQLV 210
gi 74317192   134 vlaiEPGLGYHRFVVer-aDGGGEACEMSFIVAPPACYQPPAIHG---DGRAWGIAAQLYGVRSERNWGIGDFGDLRHML 209
gi 82702531   146 vldlSVEPGYHRLFIe--kSDGLALAEMPFIMAPATCYWPPGLEG---PRRVWGPALQLYGIRSQRNYGIGDFSDLRRLV 220
gi 119898090  137 tigiELGQGYHRLSLfehaTSSHAFAEVGLAVCPPTCHPAP-------SGRLWGPSVQVYALRSARDWGMGDFGDLRRLV 209
gi 240139460  125 ----PLTPGYHRLTV----TVGDSRAQAWIVSAPQRCWRPRAYAEd--GARDWGLAAQLYGLRSPSNLGIGTYADAGRAA 194
gi 239814986  108 -laePLAPGYHWLQI------DGLAGETLLVASPGRCYRPPAVQD---GGRVWGPALQLYALRSARNWGIGDFGDLEALV 177
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380   261 DLAADAGAHVVGVNPLHALFPHDPVRASPYSPSSREWLNVLYVEIETTRDYGECAAARGRveePVFQHRLDALRATEFVD 340
gi 218530889  200 RDAALRGASFLGLSPAHALFPTDRAKISPYSPSSRLFLETLYIEPGALPGFAGSRAAEIL---ESHRARIETLRDISLVD 276
gi 188582078  204 RDAALRGASFLGLSPAHALFPTDRAKISPYSPSSRLFLETLYIEPGALPGFADSPAAALL---EQYGPRIEALRDTSLVD 280
gi 163852130  200 RDAALRGASFLGLSPAHALFPTDRAKISPYSPSSRLFLETLYIEPGALAGFAGSRAAEIL---ESHRARIETLRDISLVD 276
gi 89900940   211 GQMAERGADIIGLSPLHALFVHNPAHASPYSPSSRLQLNVLYIDVDAVDDYASCEALGRLvhsAEFQGRLARLREAPLVD 290
gi 74317192   210 EFCADSGAGSVLLNPLHAMFPDAPEHASPYSPSNRAYFNTLYLDVEEITDFGECEAVRAVvhaPHFQARLRALRAADQVD 289
gi 82702531   221 EFYASAGGSTLLLNPLHALFPDAPEHTSPYSPSSRTWFNPLYLDVEAIPEFAECEEARSIvlaPEFQARLRALRATEQVD 300
gi 119898090  210 DIAADAGAHFVGVNPLHALFPHEPERASPYSPSSREWLNVLYLDIEAMRDFGECAAAGEKvgaAAFRARLDALRARTLID 289
gi 240139460  195 RDAALRGASFLGLSPAHALFPTDRAKISPYSPSSRLFLETLYIEPGALPGFAGSRAAEIL---ESHRARIETLRDISLVD 271
gi 239814986  178 DRMAGQGTDLIGLNPLHALFPTDPPRASPYSPSSRQWINVLYIDVEAVDDFAACEAARRHvesPGFQGRLAALRAAPLVD 257
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380   341 YGGVAEAKFEVLEMLYRHFRTVHler-----ntQRAGLFRDFQREGGRSLRAHALFDALQERFFRIDPAVWGwtVWPEAY 415
gi 218530889  277 HAGVWEVLSPILEAYWEDSDARA----------GKDAGFAAFREEGGENLTSHATFDALSEHFRTKGAHWLG--DWPEEY 344
gi 188582078  281 HAGVWEVLSPILEAYWQGSGARA----------GTDAGFAAFRAEGGENLESHATFDALSEHFRKQGAHWLG--DWPEEY 348
gi 163852130  277 HAGVWEVLSPILEAYWEDSDARA----------GKDAGFAAFREEGGENLTSHATFDALSEHFRTKGAHWLG--DWPEEY 344
gi 89900940   291 YVGVAAVKFEALELLFSHFREHHltpdglqagdDAGRTFLAFVVQGGEALYRHALFEALQAHFHANDATIGGwpGWPLAY 370
gi 74317192   290 YRGVADAKAEVLRELYAHFRAEHlar-----esARGREFRAFQAAHGNSLRSQALFEALQTHFRNEDGAVWGwpVWPEAY 364
gi 82702531   301 YRGVAEAKSEVLVSLYRYFRNTHlar-----ntDRARVFRAFQAEHGEVLRKQALFEALQEYFRAEDSSVWGwrVWPEAY 375
gi 119898090  290 YNGVAQAKFEVLELLYRHFRAMHler-----dtQRAGQFRDFQREGGRSLRLHALFDALQTHFHAGDPAIWGwtTWPEAY 364
gi 240139460  272 HAGVWEVLSPILEAYWEDSDART----------GKDAGFAAFREEGGENLTSHATFDALSEHFRTKGAHWLG--DWPEEY 339
gi 239814986  258 HAGVATAKFEVLELLFEHFRARHlspa--gapdARGEAFLAFVSAQGEPLRQHALFEALQAHFAAADPQCWGwlAWPEAY 335
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380   416 RDIDAPAVEAFALANEERVEFFEYLQWQAEAQLRRVAARAQARGMAIGLYRDLAVGVNEGGSESWARPKLHALGIHAGAP 495
gi 218530889  345 RRAGTDAVRAFSETHSDRIRYHIFLQYLADTQLKASSEMALAAGMRLGLYRDLAVGADRGGSEIWSHPERFANGVSIGAP 424
gi 188582078  349 RRAGTDAVRAFAGEQAERIAYHVFLQYLADSQLKASSDLALKAGMRLGLYRDLAVGADRGGSEIWSHPERFANGVSIGAP 428
gi 163852130  345 RRAGTDAVRAFSETHADRIRYHIFLQYLADTQLKASSEMALAAGMRLGLYRDLAVGADRGGSEIWSHPERFANGVSIGAP 424
gi 89900940   371 QDPDSPEVKSFAEQHAERVRYHLYLQWLAASQLARASDHCQALGMGVGLYVDLAVSVDRAGSDVWCERACFAADASIGAP 450
gi 74317192   365 RTREAPEVSAFGEANLEQVEYFEYLQWQASLQLRAAGTRSWELGLGVGVMLDLAIGVAEGGAATWMCRDLYAFGASAGAP 444
gi 82702531   376 RDPEAPEVTAFREAHLERVEYFEYLQWQVSLQLGSVGTRSWEVGLNIGLMFDLAIGVAEGGGATWSRRELYALEASAGAP 455
gi 119898090  365 RDPDGAAVETFAADNEQRIEFFEYLQWQAALQLQAVASRARARGMRVGLYRDLAVGVNEGGSETWARRSLHAFGAHAGAP 444
gi 240139460  340 RRAGTDAVRAFSETHADRIRYHIFLQYLADTQLKASSEMALAAGMRLGLYRDLAVGADRGGSEIWSHPERFANGVSIGAP 419
gi 239814986  336 READSPEVQAFAAEHAERLQYHQYLQWVAEHQLARAGERCKALGMGIGLYLDLAVSVDRGGSDAWAARHCFAVGASIGAP 415
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380   496 PDELNPAGQDWGFPPVIPQRLAAECFEPFLAVLRANMRHAGALRIDHVMSLMRLFWLPGDG---------QRQVGAYVAY 566
gi 218530889  425 PDLLAPKGQDWGLPAFDPLEMERDGLKAFRALVRANMRHAGAIRIDHAFQLARLFLIPLGR---------SAREGAYVAM 495
gi 188582078  429 PDLLAPKGQDWGLPAFDPLEMERDGLKAFRALVKANMRHAGAIRIDHAFQLARLFLIPLGR---------SAREGAYVAM 499
gi 163852130  425 PDLLAPKGQDWGLPAFDPLEMERDGLKAFRALVRANMRHAGAIRIDHAFQLARLFLIPLGR---------SAREGAYVAM 495
gi 89900940   451 PDEFNPNGQGWGLPPLRPDRLRASQYRYFIDTLRANMRGAGALRIDHVMGLMRLFWLPPGQ---------TAREGTYVHY 521
gi 74317192   445 PDEFNRLGQDWGLPPWIPHRLKARAYEPFIELIRANMRDSGALRLDHVMGLFRLFWVARGL---------PISQGAYVAY 515
gi 82702531   456 PDDFNRLGQNWGLPPWIPHQLTSSAYAPFIEVLRANMRDSGSLRIDHVMGLRRLFWVVRGL---------PATEGAYIRY 526
gi 119898090  445 PDELNANGQDWGFPPEIPQQLADQGYAPFLAVLRANMRHAGALRIDHVMSLMRLFWLPVARnrpgeegeeARQRGAYVAY 524
gi 240139460  420 PDLLAPKGQDWGLPAFDPLEMERDGLKAFRALVRANMRHAGAIRIDHAFQLARLFLIPLGR---------SAREGAYVAM 490
gi 239814986  416 PDEFNPAGQNWGLPPLRPDHLRTHHYQPFVQMLRANMRHAGALRIDHVMGLMRLFWIPPGR---------SPHDGAYVRY 486
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380   567 PMEELLGLLCLESRSHRCVVIGEDLGIVPQEVRDAMARHAILSYRPLYFEQDwDAGGFRAPRDWPAQAVAAVSTHDLPTL 646
gi 218530889  496 PFEPMLAVLRLESHRAKCLVIAEDLGTAPEGFSDALMQSGILSYRILAFERE-QGGAFKAPEAYPKDALTAITTHDLPTF 574
gi 188582078  500 PFEPMLAVLRLESHRAKCLVIAEDLGTAPEGFSDALMHSGILSYRILAFERE-QGGAFKSPDAYPKDALTAITTHDLPTF 578
gi 163852130  496 PFEPMLAVLRLESHRAKCLVIAEDLGTAPEGFSDALMQSGILSFRILAFERE-QGGAFKAPEAYPKDALTAITTHDLPTF 574
gi 89900940   522 ALDEMLAIVALESQRNRCMVIGEDLGTVAGEVRSALARFDVLSYRLLYFERQ-DNGEFKPATDYPANALVAVSTHDLATL 600
gi 74317192   516 PFRDLLGILALESQRNRCLVVGEDLGTVPEEVRAVLQPMEVLSTRLLYFERQ-ENGRLAPPGSYPANAVAAVTTHDLPTL 594
gi 82702531   527 PFEDMLSILALESQRNRCLVIGEDLGTVPPEVREALHPANVMSTRLLYFERV-DGGRLKPPQAYPANAVVAVTTHDLPTL 605
gi 119898090  525 PMHDLFRLLCLESRRERCVVIGEDLGIVPQAIREAMARHGLLSYRPLYFQHA-DGGGLRAPDAWPQDALAVVGTHDLPTL 603
gi 240139460  491 PFEPMLAVLRLESHRAKCLVIAEDLGTAPEGFSDALMQSGILSYRILAFERE-QGGAFKAPEAYPKDALTAITTHDLPTF 569
gi 239814986  487 AVEEMLAIVAVESHRHGCMVVGEDLGTVEDAMREALARADVLSYRLLYFEKQ-QGGGFTLPAAYPAAALVAISTHDLATL 565
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380   647 RSYWSGFDLQLRDRLGMYrEPGMRDRQFERREADRCALLAALAAEK--GSGDEPNEVLGtdparvadddphlaVAVHRFI 724
gi 218530889  575 VGWWRGVDTDTRQSLGLY-DAERAEAERTERVAERWRLSEALAAQQllPSSEPPEHAPL--------------EAAARYL 639
gi 188582078  579 VGWWRGVDTDTRQSLGLY-DADRAEAERTERVAERWRLSEALAAQQllPSSEPPEHAPF--------------EAAARYL 643
gi 163852130  575 VGWWRGVDTDTRQSLGLY-DAERAEAERTERVAERWRLSEALAAQQllPSSEPPEHAPL--------------EAAARYL 639
gi 89900940   601 AGWWWGLDLRLRLQLGLFpDLQVFENQLLDRAQERVRLLSALHRAGllSAAEVADALAGpdls------ahavQAVHAFL 674
gi 74317192   595 AGYWRGLDIDLREQLRLFpDAEVRNQQVIARSEDRAQLLVALEGEQvlPPGG-VQPVAFpelt------telaVAVYTYL 667
gi 82702531   606 AGFWQGLDIDLRDRHHLFpEDEMRNRQIVERAADRAQLLVALEGEGvlPSRGGLHQVGFpemt------aelaAAVYTYL 679
gi 119898090  604 RGYWAGHDIDLREALGMYrEPGLRERQAEQRRADCRALLDALGGEAllAPGDEPPGgdeg---------gglaPAVYRYI 674
gi 240139460  570 VGWWRGVDTDTRQSLGLY-DAERAEAERTERVAERWRLSEALAAQQllPSSEPPEHAPL--------------EAAARYL 634
gi 239814986  566 AGWWSGHDLRLRLALGLFpDPRLFDAQLLDRAQERIRLTLAVREAGllSADEAAQALSLavps------primQAVHAFL 639
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380   725 ARTPAAIAVVQFEDVLGQLEGVNLPGTSEsEYPNWRRKLGAALADIEVDprwravSAAVDAERPCPLRELSGGPPDFHPE 804
gi 218530889  640 ARAPSILTAVQYEDVVGELSQANVPGSTE-GYPNWRRKLDRNLEAIAAP------GGPLAKLAAALSAEERGPRSGAARL 712
gi 188582078  644 ARAPSILTAVQYEDVVGELSQANVPGSTE-GYPNWRRKLDRNLEAIAAP------GGPLAKLAAALSAEERGPRSGAARL 716
gi 163852130  640 ARAPSILTAVQYEDVVGELSQANVPGSTE-GYPNWRRKLDRNLEAIAAP------GGPLAKLAAALSAEERGPRSGAARL 712
gi 89900940   675 AATPCALMTVQLEDALGVAEQINMPGTTD-EQPNWRRKLPLDLAALATHevmlslGRTLSGLRPRWS----GGASNRSRA 749
gi 74317192   668 GRAPSKLLLLQLEDGFGVHEQPNLPGTVSpTYPCWRLKIPINLEEWRSSeplqgiMQALRQERPVTQVAGPAGAGMEEGV 747
gi 82702531   680 ARAPSKLLLLQLEDGFGVLEQPNLPGATGdTYPSWRLKLPLNLEEWQGSawlqgiILALRRERPLSQAPSSSEGEVAQDV 759
gi 119898090  675 ARTPSAMVAVQLEDVLAQLEATNLPGTSEtTQPNWRRRLDAALADLAADarwlavSSAINTERPSAPLPVSGGPPDFRPE 754
gi 240139460  635 ARAPSILTAVQYEDVVGELSQANVPGSTE-GYPNWRRKLDRNLEAIAAP------GGPLAKLAAALSAEERGPRSGAARL 707
gi 239814986  640 AAAPSALMVFQLEDVAGEVEQANMPGTTD-THPNWRRKLLPSVQELAAGdamqglTEHLRAIRPRRSL--RAEAAPSTLL 716
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380   805 TAAIPRATYRLQFHADFGFAAAEAVLPYLAELGISHVYAAPFLKARPGSRHGYDIIDHQAVNPEIGSEADFDRYCARLAE 884
gi 218530889  713 ASAPPRATYRLQFHEGFTFADAEKTVPYLQKLGISHVYASPLQRARPGSTHGYDIVDHSQINPEIGGEEGFRSFTDALHA 792
gi 188582078  717 ASAPPRATYRLQFHEGFTFADAEKIVPYLAKLGISHVYASPLQRARPGSTHGYDIVDHSQINPEIGGEEGFRSFTDALHA 796
gi 163852130  713 ASAPPRATYRLQFHEGFTFADAEKTVPYLQKLGISHVYASPLQRARPGSTHGYDIVDHSQINPEIGGEEGFRSFTDALHA 792
gi 89900940   750 RATVPRATYRLQFHKDFTFMDAIRILPYLARLGVSHVYCSPIQRARAGSMHGYDVVDHSEVNPELGGREGFERFAAALLE 829
gi 74317192   748 RLWIPRATYRLQLNRDFKLPQAMALLPYLDALGISHCYLSPILKARPGSRHGYDITDHSSLNPEIASAEDFEQFVAEIKR 827
gi 82702531   760 QVQIPRATYRLQLNRDFNLRQATELIPYLDELGISHCYLSPLLKARPGSIHGYDVTDHGRLNPEITSARDFERFAAVLKR 839
gi 119898090  755 LADVPRATYRLQFNGDFGFAAATDVLPYLAALGISHVYAAPFLKARPGSRHGYDIVDHQAVNPEIGSDEDFDRYCARLGE 834
gi 240139460  708 ASAPPRATYRLQFHEGFTFADAEKTVPYLQKLGISHVYASPLQRARPGSTHGYDIVDHSQINPEIGGEEGFRSFTDALHA 787
gi 239814986  717 QARVPRATYRLQFHQGFGFDDAIRVLPYLAQLGVSHVYCSPIQRARAGSTHGYDVVAHAEVNPELGGAEGFARFVAALQA 796
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380   885 LGLGQVLDVVPNHVGVLGADNEWWLDVLENGEASECADHFDIDWHPPFPElrGKVLLPVLGDQYGLVLEAGELTLGFSAE 964
gi 218530889  793 HGLKLLLDIVPNHMGVGGADNPWWLSVLEWGGLSPAANAFDIDWERLGAN--GKLVIPFLGERYGEALEKGTLELKFDEA 870
gi 188582078  797 HGLKLLLDIVPNHMGVGGADNPWWLSVLEWGGLSPAANAFDIDWERLGAN--GKLVIPFLGERYGEALEKGTLELKFDES 874
gi 163852130  793 HGLKLLLDIVPNHMGVGGADNPWWLSVLEWGGLSPAANAFDIDWERLGAN--GKLVIPFLGERYGEALEKGTLELKFDEA 870
gi 89900940   830 RGMGMLLDMVPNHMGVMGGDNAWWMDVLENGPASLYAQHFDIDWQPLNPEltGKVLLPVLSDHYGDVLMSGNIVLHFEDS 909
gi 74317192   828 RGMGQIMDLVPNHMGINGADNAWWLDVLENGPASRYATYFDIDWYSNTADmsGRVLLPVLGEHYGAVLDKGELKLVFDPE 907
gi 82702531   840 HGMSQIMDVVPNHMCITGVDNEWWLDVLENGPASRFASYFDIDWYVMGEHlpGQVLLPVLGDHYGTVLENGELKLAFDIE 919
gi 119898090  835 LGLGQVLDVVPNHVGVLGGDNEWWLDVLENGPASHFADHFDIDWEPPFAElrGKVLLPVLGDQYGLVLEAGELELSFSPE 914
gi 240139460  788 HGLKLLLDIVPNHMGVGGADNPWWLSVLEWGGLSPAANAFDIDWERLGAN--GKLVIPFLGERYGEALEKGTLELKFDEA 865
gi 239814986  797 HGLGQLLDMVPNHMGVLGADNAWWMDVLENGPASLFAHHFDIDWQPLNKElaGKVLLPVLGGHYGEVLASGELALHFEAA 876
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380   965 RGEFSVHYFEHRFPVDPCDYPSILTPAASa---------------rGAQSVVDAEQVELETLLAALRHLPprDVADPALQ 1029
gi 218530889  871 AGAFSVWHYEHQFPICPLQYPTILNRALA-----------------ALGEIGDDMSAEVLAITERLRAMG--EETNLERR 931
gi 188582078  875 AGAFSVWHYEHQFPICPLQYPTILNRALA-----------------ALGEIGDDMSAEVLSITERLRAMG--EETNFERR 935
gi 163852130  871 AGAFSVWHYEHQFPICPLQYPTILNRALA-----------------ALGEIGDDMSAEVLAITERLRAMG--EETNLERR 931
gi 89900940   910 TGSLALRYFDHCFPLAPESYPQVLMLAQA-----------------RLGDV--DLAASLASTATAFGHLPgrDASDPGAR 970
gi 74317192   908 DGAFSVFYYEHRFPVDPREYPRILGHGLErl--------------qARLGAEDIVLLEFQALVTTFGHLParDRVTPEAV 973
gi 82702531   920 QGSFSVFYHEHRFPVDPREYPRILGHDLRrl--------------eMRLGEQHPEFLELQSLITALTHLPlrERVSPDAV 985
gi 119898090  915 RGSFCVRYYEHRFPIDPCDYPEILAAGAAdplpplqgesrggegagAGASSTSEPSLELATLLAALRRLPprDTADPEAL 994
gi 240139460  866 AGAFSVWHYEHQFPICPLQYPTILNRALA-----------------ALGEIGDDMSAEVLAITERLRAMG--EETNLERR 926
gi 239814986  877 HGSFALRYFDHRFPLAPESYPVVLACALP-----------------HLKDP--MLAAQLASLSAAFGHLPsrRAQTPAEC 937
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380  1030 TERRHNKNLFKQHLAALHERLPAVRARIGERLAAFNG-RVGEPASFDALDALLARQAYRLASWRVAADDINYRRFFDIND 1108
gi 218530889  932 RAMPEAAEELKRQLAGTVRASPQIAASIYRALHLLNG-NRDYPDSFGPLHRLLEQQSYRLAHWRIASSDINYRRFFDVNS 1010
gi 188582078  936 RAMPEAAEELKRQLAGAVRASPQIAASIYRALHLLNG-NRDYPDSFGPLHRLLEQQSYRLAHWRIASSDINYRRFFDVNS 1014
gi 163852130  932 RAMPEAAEELKRQLAGTVRASPQIAASIYRALHLLNG-NRDYPDSFGPLHRLLEQQSYRLAHWRIASSDINYRRFFDVNS 1010
gi 89900940   971 TERARDKELLKTRLARLAARQASVAQAIASAVAELNL-----AGARDALHALIEAQAYRLAYWRVAVDEINYRRFFDINE 1045
gi 74317192   974 AERSRDKEVHKHRLAALYAGSADVARFIDENLAEFNG-IGQAGANFDLLHELLQSQAYRLAFWRVAADEINYRRFFDIND 1052
gi 82702531   986 AERVRDKEIHKRHLASLFVKSADIAQFVQENITLFNGdAPGQPRNFDLLHELLAVQAYRLAFWRAAADEINYRRFFDIND 1065
gi 119898090  995 AERRRDKETFKRHLAELYARLPALQAQVAAGLAAYRG-HVGEPESFDALDHLLQRQAYRLASWRVAADDINYRRFFDVND 1073
gi 240139460  927 RAMPEAAEELKRQLAGTVRASPQIAASIYRALHLLNG-NRDYPDSFGPLHRLLEQQSYRLAHWRIASSDINYRRFFDVNS 1005
gi 239814986  938 TERVRDKELFKARLAHLAEAHPSLARAVLAAVAEFNL-ASEEAR--DQLHRLIDLQAFRLAYWRVAADEINYRRFFDIND 1014
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380  1109 LAALRMEVDSVFEATHAQIFRWLAQGRVSGLRIDHPDGLAEPVAYFERLQARHAaicrelalaggtpsagpePALYLVVE 1188
gi 218530889 1011 LAGLRVELSDVFVRSHDLLFRLIGEGRIDGLRIDHIDGLADPLGYARALQAAVG------------------PGFYIVVE 1072
gi 188582078 1015 LAGLRVELSDVFTKSHDLLFRLIGEGRIDGLRIDHIDGLADPLGYARALQAAVG------------------PGFYIVVE 1076
gi 163852130 1011 LAGLRVELSDVFVRSHDLLFRLIGEGRIDGLRIDHIDGLADPLGYARALQAAVG------------------PGFYIVVE 1072
gi 89900940  1046 LAALRMEREDVFEATQSFALDLAAAGLVDGLRIDHPDGLYDPARYFQQLQEGYArragllleg-pdeqgrpaRPLYVVAE 1124
gi 74317192  1053 LAALRMDNPEVFEATHRLLHELLGRGYINGLRIDHPDGLYAPKAYFERLQAMAAtlmpkvgn---ghaestpRPLYLIVE 1129
gi 82702531  1066 LAALRMDNPEVFESTHRLVRELIARGYVSGLRIDHPDGLYAPQEYFERLQAMAAaalfpg------tvkdgaKSLYIVAE 1139
gi 119898090 1074 LAALRMENDAVFEATHARIFDWVAQGRVSGLRIDHPDGLADPAAYFERLQTRYGevagg--------glappRALYVVVE 1145
gi 240139460 1006 LAGLRVELSDVFVRSHDLLFRLIGEGRIDGLRIDHIDGLADPLGYARALQAAVG------------------PGFYIVVE 1067
gi 239814986 1015 LAAVRMERDEVFEATQSFALDLAAAGVVDGLRIDHPDGLYDPARYFRQLQEGYArragivlpa-tgpdgrpaRPLYVVAE 1093
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380  1189 KILAEFEPLpADWPVHGDTGYRFANLCNGLFVDSAQESRFSRIYRAFTGEARNFSEVLHEAKLLIMTHSLPGEVSGLAGL 1268
gi 218530889 1073 KILEPGEKL-RDWPVAGTTGYDVLNQLDGILVDRALKPRIEKFYRWATDMDTPYGFQFRAAKAEILEISFASELEVMTGD 1151
gi 188582078 1077 KILEPGEKL-RDWPVAGTTGYDVLNQLDGILVDQALKPRIEKFYRWATDMDEPYGFQFRAAKAEILEISFASELEVMTGD 1155
gi 163852130 1073 KILEPGEKL-RDWPVAGTTGYDVLNQLDGILVDRALKPRIEKFYRWATDMDTPYGFQFRAAKAEILEISFASELEVMTGD 1151
gi 89900940  1125 KIAALHEEIpLDWHIHGMTGYRFANSVNGLLVDPSAAAKFALIWRNFTAISESFDELAYAGKRDIIRTSLASELNVLSTE 1204
gi 74317192  1130 KILAVHEHLpESWAVHGTTGYDFAAACTGLFVDASAADAFTRTYQGFIRARPAYEEMVRANKHLIMQTSLAGELQVLATQ 1209
gi 82702531  1140 KILASYEHLpKAWSIHGTTGYDFAAACTGLFVDTHAAGEFTRIYERFIRARPDLDAMIRANKHLIMDRALAGELQVLAIQ 1219
gi 119898090 1146 KILGEFEGLpADWPVHGGTGYRFANLVNNLFVDPAQESRFTRIYRAFTGEMRDFAEVLVESKQLIMTHSLPGELGSLAYM 1225
gi 240139460 1068 KILEPGEKL-RDWPVAGTTGYDVLNQLDGILVDRALKPRIEKFYRWATDMDTPYGFQFRAAKAEILEISFASELEVMTGD 1146
gi 239814986 1094 KIAASEEEVpAEWHVHGTTGYRFANVANGVLVDTAAADALRQAWHGFTGEAQDFGSVARAGKREVMRSALSSELNVLSSE 1173
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380  1269 LHDIAQHDRRTRDFTRSRLRGALKEIVAGFPVYRTYIGP----RGVSDTDRRYIERAIATAAARTRAGDATVLRFVRDVL 1344
gi 218530889 1152 LKQIADSDRRTRDFSTNAIRRALIEIVARFPVYRSYLPGdldeTEIEAEDVRLIEGAVRKAKRWSALPDRSVHDFAADAL 1231
gi 188582078 1156 LKQIADSDRRNRDFSTNAIRRALIEIVARFPVYRSYLPGdldeTEIEAEDVRLIEGAVRKAKRWSALPDRSVHDFAADAL 1235
gi 163852130 1152 LKQIADSDRRTRDFSTNAIRRALIEIVARFPVYRSYLPGdldeTEIEAEDVRLIEGAVRKAKRWSALPDRSVHDFAADAL 1231
gi 89900940  1205 LLRIARADRRTRDYTLNALRRALTEVAACLPVYRTYFID-----QASAQDQRYVDWAVRDAEHHSQDADLSIFGFVRQTL 1279
gi 74317192  1210 LTRLAKEDRCTCDFTLNSLRSAIAEIVASFPVYRTYVTP----GETSADDVRYVDWAVGVAKKRSR-ADPSIFDFVRDAM 1284
gi 82702531  1220 LARIAKGDRRTCDFTFNSQHSALAQVVANFPVYRTYVSD----CESSADDVRYADWAVEVAKKRSQAVDTTIFDFVRDVL 1295
gi 119898090 1226 LYDIAQHDRRTRDFTRSRLRGALAEVIAAFPVYRSYIGP----RGVGEDDRRYVERAVEAAVARGLAGDASVLHFVREVL 1301
gi 240139460 1147 LKQIADSDRRTRDFSTNAIRRALIEIVARFPVYRSYLPGdldeTEIEAEDVRLIEGAVRKAKRWSALPDRSVHDFAADAL 1226
gi 239814986 1174 LLRIARADRGTRDYTLNALRRALAEVAACMPVYRTYIVD-----APSAQDAHFIDAATEAAERQSVDADRSVFAFVRRSL 1248
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380  1345 VS--APSETAAELRLLKLRFVRRFQQFTAPVMAKSMEDTAFYRYNRLVSLNDVGGDPHTFGIAVQDFHAANERVAASHPF 1422
gi 218530889 1232 LGrtDLGSAGHPDQQVVLRFRRRFQQLTGPVMAKSLEDTLFYRFVELLGLNEVGGDPGEYGLDAEHFHALQAARARDWPN 1311
gi 188582078 1236 LGrlDLGGAGHPDQQVVLRFRRRFQQLTGPVMAKSLEDTLFYRFVELLALNEVGGDPGEYGIDAEHFHALQAARARDWPN 1315
gi 163852130 1232 LGrtDLGSAGHPDQQVVLRFRRRFQQLTGPVMAKSLEDTLFYRFVELLGLNEVGGDPGEYGLDAEHFHALQAARARDWPN 1311
gi 89900940  1280 LGq-ALPDASDSLRQRVRRFANRFQQFSAPVAAKGVEDTAFYRYFPLCSLNEVGGDPSRFGVTVAAFHADNATRAEHWPH 1358
gi 74317192  1285 LGrlGRVD-RDDYREAVAAFAMKFQQYSSPVTAKAVEDTTFYQYNRLVALNEVGAEPQRFGVSLAAFHRENQERSRRWPH 1363
gi 82702531  1296 LGr-QAKGQAEAYRNAICTFAMKFQQYTSPVMAKAMEDTTFYQYNRLVSLNEVGNEPQRFGVSLAAFHRENQERASHWPH 1374
gi 119898090 1302 LS--APIEPRPELRRLKLRFVRRFQQFTAPVMAKAMEDTAFYRYNRLVSLNDVGGDPRTFGVGVEDFHLANEALACGHPF 1379
gi 240139460 1227 LGrtDLGSAGHPDQQVVLRFRRRFQQLTGPVMAKSLEDTLFYRFVELLGLNEVGGDPGEYGLDAEHFHALQAARARDWPN 1306
gi 239814986 1249 RGeaAAAHAPPALAGRVRRFAMRFQQFSAPVAAKGVEDTSFYRYFPLSSLNEVGGEPDQFGFDVPEFHALSADRARHWPH 1328
                        1450      1460      1470      1480      1490      1500      1510      1520
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380  1423 GLVGSSTHDSKRSEDVRARIDVLSEMPGAWRLALRRWRKLNERHKRRVNDAL----APSCNDEYLLYQTLLGVWPATP-- 1496
gi 218530889 1312 AMITTATHDTKRGEDARTRQLALSELPEEWARAWDTWRRASEPLIKQVEGEP----APDPNDQWMFLQAILGAWPLELld 1387
gi 188582078 1316 AMITTATHDTKRGEDARSRQLALSELPEEWARAWDTWRRASEPHIKQVEGEP----APDPNDQWMFLQAILGAWPLELle 1391
gi 163852130 1312 AMITTATHDTKRGEDARTRQLALSELPEEWARAWDTWRRASEPLIKQVEGEP----APDPNDQWMFLQAILGAWPLELld 1387
gi 89900940  1359 NMLATSTHDNKRSEDVRNRINVLSEMPARWRLALRRWRSQHRGLRHKLEAASaavgAPSHADEYLLYQTLLGTLPVGD-- 1436
gi 74317192  1364 AMLASSTHDTKRSEDVRARLCVLSEVPELWHQALSRWSNLNRSKRRRLGESR----VPSRNDEYLLYQTLLGIWPFDA-- 1437
gi 82702531  1375 AMLSTSSHDSKRSEDVRARISVLSEIPDQWAQALKRWNRLNRSSRWELDNTY----APSRNDEYLLYQILLGIWPFDT-- 1448
gi 119898090 1380 GLLATSTHDSKRSEDVRARISVLSEMPGAWRLALRRWGRLNARRKQRVNDEP----APSANDEYLLYQTLLGVWPLGA-- 1453
gi 240139460 1307 AMITTATHDTKRGEDARTRQLALSELPEEWARAWDTWRRASEPLIKQVEGEP----APDPNDQWMFLQAILGAWPLELld 1382
gi 239814986 1329 TMLATSTHDNKRSEEVRNRIDVLSEMPSEWRDALARWHALCRGGEQAEA-------APSRADEYLLYQTLLGTLPFGG-- 1399
                        1530      1540      1550      1560      1570      1580      1590      1600
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380  1497 -PESRGLAELARRVDAYMLKAAREAKRHTSWMNPEPGYEAALSGFVRRLFAGglDNPFVADFLPFHARVSCFGCYNSLAM 1575
gi 218530889 1388 gDDPGAIEDFRKRLDAYAEKALRESKRRSSWVNVDEGYESAVHALFAALVVP--GSDCLDRLRPLVRRLAFLGMIAGLGR 1465
gi 188582078 1392 gDDAGEIETFRKRLDAYAEKALRESKRRSSWVNVDEGYEGAVHALFAALVTP--GSDCLNRLRPLVRRLAFLGMIAGLGR 1469
gi 163852130 1388 gDDAGAIEDFRKRLDAYAEKALRESKRRSSWVNVDEGYESAVHALFAALVVP--GSDCLDRLRPLVRRLAFLGMIAGLGR 1465
gi 89900940  1437 -LNETTLAPYRERVVLYMQKAAREAKLHTRWTHPDENYEAALEGFVRALLGHieNNTFLTELQTLGVTLAWFGALNSLST 1515
gi 74317192  1438 -PDADTLASLAARLRTYMLKAVREGKTHSSWISPDTAYEDAVGDFVSALLSAdaGNLFLRDFAPFQAGVARAGAFNSLSQ 1516
gi 82702531  1449 -PHAEELANLSDRVVAYMRKAAREAKVNSSWINPDSEYEAAMQDFVHALLSEqpTNLFLRDFLPFQQRVAWVGAFNSLSQ 1527
gi 119898090 1454 -MDTSATAQLAERVEAYMLKAAREAKRHTSWMNPDAGYEAALTAFVRRLFVP--DGGFLADFLPFQATVARFGIYNSLNM 1530
gi 240139460 1383 gDDPGAIEDFRKRLDAYAEKALRESKRRSSWVNVDEGYESAVHALFAALVVP--GSDCMERLRPLVRRLAFLGMIAGLGR 1460
gi 239814986 1400 -LDAADVPAYAARVWQYMQKAAREAKLHTRWTQPDAPYEAALEGLVQRILSDlsKDGCLADIQRLADRLSWFGAWNGLTL 1478
                        1610      1620      1630      1640      1650      1660      1670      1680
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380  1576 ALLKLTAPGVPDIYQGCETWNYRLVDPDNRFPVDFAAARDLLHGLkqecpdGAdearrrsalatmLDAMSEGRDDGRIKL 1655
gi 218530889 1466 TVLKCTLPGIPDTYQGTEFWDFSFVDPDNRRPVDYAERARALEAG------GT------------PDALIGSWQDGRVKQ 1527
gi 188582078 1470 TVLKCTLPGIPDTYQGTEFWDFSFVDPDNRRPVDYEERARALEAG------GA------------PSELIGAWPDGRVKQ 1531
gi 163852130 1466 TVLKCTLPGIPDTYQGTEFWDFSFVDPDNRRPVDYVERARALEAG------GT------------PDALIGSWQDGRVKQ 1527
gi 89900940  1516 TLLKLSSPGVPDFYQGHETIGLTLVDPDNRRPVDYEALNQSLASL------ESldp-------tqLPTLMTAPQDGRAKL 1582
gi 74317192  1517 LLLKLASPGVPDVYQGCEMWDFSLVDPDNRRPVDYARRQRALQAV------RTmhaeq--gaaacTEALLARLQDGEIKL 1588
gi 82702531  1528 VLLKLTSPGVPDIYQGNETWDFSLVDPDNRRPVDYTARRRSLQAI------RSmhaee--gpgacAQHLMENLRDGRIKL 1599
gi 119898090 1531 LLLKLAAPGVPDIYQGCEDWNFSLVDPDNRRPVDFGAAAARFEAL------RDefpdg--agpaeLLNLLDNAEDGRIKL 1602
gi 240139460 1461 TVLKCTLPGIPDTYQGTEFWDFSFVDPDNRRPVDYAERARALEAG------GT------------PDALIGSWQDGRVKQ 1522
gi 239814986 1479 TLLKYGSPGVPDLYQGSELIDLSLVDPDNRRPVDYELRSRRLDEL------QAmaggh--dlaarVQALAGSPHDGRAKL 1550
                        1690      1700      1710      1720      1730      1740      1750      1760
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56479380  1656 YVLWRALAVRREFEQTMRFGRYVALETDGPAALHVVAFAR---VLGDDIVVVVASRLLFTLCrg---dAALLRDPTIWQD 1729
gi 218530889 1528 ATLARLLADRAARPAFYADADYRPLPAEGARADHVIAFTRsavTSGEDDLLVAVPRLVARMT------PESGWSSEAFAG 1601
gi 188582078 1532 ATLARLLADRAARPAFYADADYRPLAAEGARADHVIAFTRsaaTSGEDDLLVAVPRLVARLT------PESGWSGEAFAG 1605
gi 163852130 1528 ATLARLLADRAARPAFYADADYRPLPAEGARADHVIAFTRsavTSGEDDLLVAVPRLVARMT------SESGWSSEAFAG 1601
gi 89900940  1583 WITWRLLALRRERPALFRDGDYTALKVSGAHAQHVVAFTR---RHEGATLVVIAGRLFARLLge---aILPPLGESVWAD 1656
gi 74317192  1589 YLVWRLLAFRRAYEALFREGDYVPLKVHGARAEQICAFSR---QAGGDALVLVVPRLIARLVwe---sDALLVGEAVWGD 1662
gi 82702531  1600 YLTWKALTFRREHEQLFRDGDYLPLKAHGDCSEHVCVFAR---RRENEIIVVAVPRLLGKLIge---qHRFPVGKSIWTD 1673
gi 119898090 1603 YLLWRGLMLRQAFERTLRGGRYVPLDVEGPAARHVVAFAR---VRGEERVVVIATRLLYGFAgg---dAGRVLMPEAWAG 1676
gi 240139460 1523 ATLARLLADRAARPAFYADADYRPLPAEGARADHVIAFTRsavTSGEDDLLVAVPRLVARMT------SESGWSSEAFAG 1596
gi 239814986 1551 WFIWRLLSMRRSHAELFREGSYEGLAGEGPLARHVVAFAR---RHEGRTLVVMAGRLFAGIAcagadgVPVLPDAEAWRG 1627
                        1770      1780      1790      1800      1810
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 56479380  1730 TFVELpafSEGRQWRDALCGQGVRPQCAgn----rcHLDVARLFGALPLALLVPQRM 1782
gi 218530889 1602 TVLPV---PAGSRWVDVVGGGEITAEGD--------GLDLGRHFAKLPYLVLRRAA- 1646
gi 188582078 1606 TVLTV---PDGSRWVDVIGGGEVAAEGD--------RLDLGRLFATLPYVVLRRAA- 1650
gi 163852130 1602 TVLPV---PAGSRWVDVVGGGEITAEGD--------GLDLGRHFAKLPYLVLRRAA- 1646
gi 89900940  1657 TTVAIn-lPDGTRLTNALTDETLIVEHG--------HIKLGAAFARLPAAALLGPT- 1703
gi 74317192  1663 TWIELppeRVRPGWVDVLTERGVDTRGFgd----stGLSVAETLATVPFAVLHAAPA 1715
gi 82702531  1674 TWVELpsdELREKWINVLTGEILATQRTeea---cgKFGLAHLFGTFPYALLSPFEQ 1727
gi 119898090 1677 NTVVLp--WHGLHLRDALCGRELWVGHGggeggpghGIDLGTVFDPLPFALLVAEGG 1731
gi 240139460 1597 TVLPV---PAGSRWVDVVGGGEITAEGD--------GLDLGRHFAKLPYLVLRRAA- 1641
gi 239814986 1628 TRVVLpedLGGATLVNVLTGESLAAEDR--------VVSLKDAFCRMPWAIFQK--- 1673
Citing CDD
Marchler-Bauer A et al. (2013), "CDD: conserved domains and protein three-dimensional structure.", Nucleic Acids Res. 41(D1):D384-52.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap