Conserved Protein Domain Family
chaperone_ClpB

?
TIGR03346: chaperone_ClpB 
ATP-dependent chaperone ClpB
Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins [Protein fate, Protein folding and stabilization].
Statistics
?
PSSM-Id: 234173
View PSSM: TIGR03346
Aligned: 24 rows
Threshold Bit Score: 1457.09
Threshold Setting Gi: 94985312
Created: 11-Sep-2012
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

TIGR03346 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77917974    6 MTQKTQEALQAAQDIALKRGHVEVDGEHLLAALLEQEGGLVPRLLQKMDVQVGNLAAAVKKELDRRASVSGPGvegGK-- 83
gi 37523146    9 FTEKAWDAIVRTTEVAKEYRQQQLESEHLFKALLDQDGGLAGSIFTKAGVNLTKLGERVEQFINRQPKLTNPG---QS-- 83
gi 103487872   6 FTDRAKGFLQAAQTIAIRMNHQRISPEHIAKALLEDSQGMAAGLIANSGGDTARAVAGIDALLAKLPAVSGSG---AQat 82
gi 113953637   8 FTEKAWSAITSAQQLAQNRRHQQLESEHLLRALLDQE-GLAGRILDKAGVSSTALQTSVDTFLSQQPALSNAP---DS-- 81
gi 163848669   8 FTQKSYEAIAAAQAAAERLGNAEVQPEHLLYALLDQSDGVVPQVLAKLNLPVGALKQQINNEISRFPRMSGGG---AQ-- 82
gi 94971790    8 LTVKAQEAYSRANDLASEHGNPELRPVHVLAALLEDREGIIVPLLSKMGVRPEAVTQATAREIERMPKVSGSA---TQ-- 82
gi 46580283    6 FTEKSQQALAEAQNIAVRFGHQEVDAEHLADALVRQEQGLVPRLLDRMGQKPEAFAEALERELGKRPAVSGPGaapGQ-- 83
gi 42524440    1 MTRKSQEAMQAAARLAERKSSPSVEPEHLLMELVQQTEGIVPRILDKLNVPQAQFLAELRTKIDKFPQVTGGG---QK-- 75
gi 19705246   13 FTENTISAINLAVDISKGNMQQSIKPEALALGLLMQNNGLIPRVIEKMGLNLQYIISELEKEMNNYPKVEVKVs-nEN-- 89
gi 29350005    6 FTIKSQEAVQEAVNLVQSRGQQAIEPAHILHGVMKVGENVTNFIFQKLGMNGQQVALVVDKQIESLPKVSG-----GE-- 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77917974   84 VYVTQRLNRLLLKAEEEARHLRDDYVSVEHLLLAMVGE-GD-ATalGK-LFKQFNIHRDRLLEALTAIRGHQRVTSPEPE 160
gi 37523146   84 VYLGRSLDALLDRAEGFRKEYGDDFISIEHLVLAFAKD-VR-FG--QQ-ILREFSLDEAKLKAVVAQVRGNQKVTSQNPE 158
gi 103487872  83 PGLDNDAVRLLDQAEQVAAKAGSEYVAVQNILLAMVLA-PS-TPv-GK-AFADAGVSADALNAAIAKLTGGRTADTASAE 158
gi 113953637  82 VFLGKGLNALLDRAETLKQSYGDSFISIEHLLLALADD-GR-CG--RQ-LLSQAGTDTSRLKTAINAVRGSQKVTDQNPE 156
gi 163848669  83 VQLGSRLRTVLIKAHDELAQFGDEYVSTEHLLLAILDHaGG-GA--ER-VLKQAGLTRDKLLMVLREVRGAQRVTSPTPE 158
gi 94971790   83 ATLSNEAQEMLELAFKQADQFKDEYVSTEHLLLGIAQL-KR-DA--AKdILGSMGATYDRILSALTGIRGNQKVTDQNPE 158
gi 46580283   84 IFVSKRLNAVLVKAQDFARQLKDEYVSVEHIFCVLLEE-PA-STimGR-IAREFSLSREKVLGVLEDVRGSQRVTSANPE 160
gi 42524440   76 MFASPRLEKIFQAAETEAQEWGDSYISTEHFFMAMLKG-GDsEL--NG-LFKKNKVTAEAARTALTEIRGKQKVTDDDPE 151
gi 19705246   90 ISLDQKTNSILNRAEKIMNEMEDSFLSVEHIFKAMIEE--------MP-IFKRFGISLEKYMEVLMNIRGNRKVDNQNPE 160
gi 29350005   79 PYLSRESNEVLQKATQYSKEMGDEFVSLEHILLALLTV-KS-TV--ST-ILKDAGMTEKELRNAINELRKGEKVTSQSSE 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77917974  161 STYEALEKYGRDLVQEVQKGKLDPVIGRDAEIRRVIRILSRKTKNNPVLIGEPGVGKTAIVEGLAHRIVRGDVPEGLKNK 240
gi 37523146  159 STYESLDKYGRDLTQLAREGKLDPVIGRDEEIRRTIQILSRRTKNNPVLIGEPGVGKTAIAEGLAQRIVSGDVPESLQGR 238
gi 103487872 159 DRYDALRKFARDLTEVAREGKLDPVIGRDEEIRRTVQILARRTKNNPVLIGEPGVGKTAIAEGLALRIVNGDVPDSLKDR 238
gi 113953637 157 GTYESLEKYGRDLTSAAREGKLDPVIGRDEEIRRTIQILSRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGDVPQALQNR 236
gi 163848669 159 GTYAALEQYGRDLTELAARNKLDPVIGRDEEIRRVIQILSRRTKNNPVLIGEPGVGKTAIVEGLAQRIVRGDVPEALKNK 238
gi 94971790  159 AKYQALERYARDLTDLARRGKLDPVIGRDDEVRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQRIVSGDVPEQLRNK 238
gi 46580283  161 DTYEALQKYGRDLVEEARKGKLDPVIGRDAEIRRVIRILSRRTKNNPVLIGEAGVGKTAIVEGLAHRILKGDVPEGLKER 240
gi 42524440  152 NKYEVLNKYARDLTALAAEGKLDPVVGRDEEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIAEGLALRIIKQDVPDNLIGK 231
gi 19705246  161 ATYEVLEKYAKDLVELAREGKIDPIIGRDSEIRRAIQIISRRTKNDPILIGEPGVGKTAIVEGLAQRILNGDVPESLKNK 240
gi 29350005  154 DNYQSLEKYAINLNEAARSGKLDPVIGRDEEIRRVLQILSRRTKNNPILIGEPGTGKTAIVEGLAHRILRGDVPENLKNK 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77917974  241 TVFALDMGALVAGAKFRGEFEERLKAVLNEIRSSEGRILLFIDELHTIVGAGKAEGSMDAGNMLKPMLARGELHCIGATT 320
gi 37523146  239 KLIALDMGALIAGSKYRGEFEERLKAVLNEVTKSEGQIVLFIDEIHTVVGAGATQGAMDAGNLLKPMLARGELRCIGATT 318
gi 103487872 239 RLLALDMGALIAGAKYRGEFEERLKGVLDDVKAAEGEIILFIDEMHTLVGAGKSEGAMDASNLLKPALARGELHCIGATT 318
gi 113953637 237 QLIALDMGALIAGAKYRGEFEERLKAVLKEVTNSEGQIVLFIDEIHTVVGAGATGGAMDASNLLKPMLARGELRCIGATT 316
gi 163848669 239 RVIALDLGALIAGAKYRGEFEERLKAVLKEIQERD-DIILFVDELHTVVGAGAAEGAMDAGNMLKPMLARGELHMVGATT 317
gi 94971790  239 RLVSLDLGAMLAGAKYRGEFEDRLKAVLKEIEESDGRIILFIDELHTLVGAGAAEGAIDASNMLKPALARGELRAIGATT 318
gi 46580283  241 GLFALDMGALIAGAKYRGEFEERLKAVLKEVEKSEGRIIMFIDELHTIVGAGKTDGAMDASNLLKPMLARGELHCIGATT 320
gi 42524440  232 KLMSLDMGALIAGAKYRGEFEDRLKAVIKEVTSSDGQIILFIDELHTLVGAGKTEGAMDAGQLLKPALARGELRCIGATT 311
gi 19705246  241 KIFSLDMGALVAGAKYKGEFEERMKGVLKEVEESNGNIILFIDEIHTIVGAGKGEGSLDAGNMLKPMLARGELRVIGATT 320
gi 29350005  234 QVYSLDMGALVAGAKYKGEFEERLKSVVNEVKKSEGDIILFIDEIHTLVGAGKGEGAMDAANILKPALARGELRSIGATT 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77917974  321 LDEYRKYIEKDAALERRFQPVVVDQPTVEDTISILRGLKERFEVFHGVRIQDNALVASAILSNRYISDRFLPDKAIDLVD 400
gi 37523146  319 LDEYRKYIEKDAALERRFQQVYVDQPTVEDTISILRGLKERYEVHHGVRISDSALVAAAVLSHRYISDRFLPDKAIDLMD 398
gi 103487872 319 LDEYRKHVEKDPALQRRFQPVFVGEPTVEDSISILRGIKEKYELHHGVRITDGAIVAAATLSHRYISDRFLPDKAIDLMD 398
gi 113953637 317 LDEHRQHIEKDPALERRFQQVLVDQPTVEDTISILRGLKERYEVHHGVRIADSALVAAAVLSSRYIADRFLPDKAIDLVD 396
gi 163848669 318 LDEYRKHIEKDAALERRFQPVMVDPPSVEDTISILRGLKERYETHHGVRITDGALIAAAMLSDRYISDRFLPDKAIDLID 397
gi 94971790  319 LNEYRKYIEKDAALERRFQIVFVGQPTVEDTIAILRGLKEKYEVHHGVRIKDSAIVAAATLSHRYITDRFLPDKAIDLID 398
gi 46580283  321 LDEYRKYIEKDPALERRFQPVLVDEPTIEDAISILRGLKERFEVHHGVRISDSAIVEAVTLSHRYITDRQLPDKAIDLID 400
gi 42524440  312 LDEYRKYIEKDAALERRFQTVMVEEPSVEDAITILRGLKEKYEVHHGIRITDAALVSAVKLSHRYITNRFLPDKAIDLID 391
gi 19705246  321 IDEYRKYIEKDPALERRFQTILVNEPNVDDTISILRGLKDKFETYHGVRITDTAIVEAATLSQRYISDRKLPDKAIDLID 400
gi 29350005  314 LDEYQKYFEKDKALERRFQIVQVDEPDTLSTISILRGLKERYENHHHVRIKDDAIIAAVELSSRYITDRFLPDKAIDLMD 393
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77917974  401 EACATIRTEIDSLPAELDEVTRRVMQLEIEEAALKKEKDAASQARLETLRKELADLKHQADVLTAQWDKEKGAIKGVQGL 480
gi 37523146  399 EAAAKLKMEITSKPEALDEVDRKILQLEMERLSLAKESDAASRDRLERLEKELADLKEEQRSLNAQWQAEKDIIDQVQAV 478
gi 103487872 399 EAASRIRMEVESKPEEIETLDRRIIQMKIEEAALGKESDAASKDRLASLQAELANLEQQSAELTQKWQAEKEKIHAEAKI 478
gi 113953637 397 ESAARLKMEITSKPEEIDEIDRKILQLEMEKLSLGRESDAASQERLQRLERELAELSEQQSTLNAQWQQEKGAIDELSAL 476
gi 163848669 398 EAAARLRMEITSDPQELDDLKRRIMQLEIEREALRKEKDQASKERLEKLEQELANLREQRSALEAQIQRERQELERIQQL 477
gi 94971790  399 EAAASLRIQIDSLPTEVDELERRITQLEIERQALKREEDTNSRERLAVIEKELAGLRERSNALKARWKDEKQSIGRIREL 478
gi 46580283  401 EAAALIRTEIDSLPADLDEANRKIMQLEIEREALRRETDVASRERLERLENELADLRAEQTALLSQWEREKGSIDHVRSI 480
gi 42524440  392 EAASKLGIETRSVPEEVDKIERELMQLRIEKEALKKEKDESARERLAVIDKEITELNAKNQLLREQWEFEKGGIEGIKKL 471
gi 19705246  401 EAAAMIRTEIDSMPEELDQLTRKALQLEIEIKALEKETDDASKERLKVIEKELAELNEEKKVLTSKWELEKEDISKIKNI 480
gi 29350005  394 EAAAKLRMEVDSVPEELDEISRKIKQLEIEREAIKREND---KPKLEIIGKELAELKEVEKSFKAKWQSEKTLMDKIQQN 470
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77917974  481 REQIEQVRQQIEVAERNYDLNRAAELKHGQLPELERRLHEQEHDSADETgg---aR---LLREEVTEEEIAEIISRWTGI 554
gi 37523146  479 KEEIDQVNVQIQQAERDYDLNRAAELKYGKLSELQKRLDAADKQLSETQts--grS---LLREEVTEEDIAEIISKWTGI 553
gi 103487872 479 KEELDAARSALEQAQRAGDLAKAGELSYGTIPALEKRLAEAEAASGN--------A---MLREEVTADDIAAVVSRWTGI 547
gi 113953637 477 KEEIERVQLQVEQAKRNYDLNKAAELEYGTLAGLQKQLLAQEQALVETDd----nAeksLLREEVSEDDIAEVIAKWTGI 552
gi 163848669 478 KEKIEQTRAAIEQAQRQYDYNKAAELQYGTLVSLERELQAAEAQLGSQs------R---LLRQEVTETDIAEIISKWTGI 548
gi 94971790  479 KEKIEQIKLQAQTASNKGDYEKAAQLQYGELPKLQAELDNLSAESDSKTs----pR---MLKEEVDEEDVAKIVSKWTGI 551
gi 46580283  481 KEDIERTRHAIEEAERAYDLNRAAELKYSRLLELERQLESAEKGGHDET------R---LLKEEVRPDDIAEIVARWTGI 551
gi 42524440  472 KADIEDLKVAVAKAEREGDLGKAAELKYGKLPEAEKKLKALEERSKEGAksssenR---MLKEEVGPEDVAEVVAKWTGI 548
gi 19705246  481 KREIENVKLEMEKAEREYDLTKLSELKYGKLATLEKELQEQQNKVDKDGke---nS---LLKQEVTADEIADIVSRWTGI 554
gi 29350005  471 KVEIENLKFEAEKAEREGDYGKVAEIRYGKLQALDKEIEDTQEKLRGMQg----dKa--MIKEEVDAEDIADVVSRWTGI 544
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77917974  555 PVTRLVEGEREKLLKLDEVLHRRVVGQDEAVQLVADAVIRARAGIKDPRRPIGSFIFLGPTGVGKTELARTLAEALFDSE 634
gi 37523146  554 PVSKLVASEREKLLHLEDELHKRVVGQEEAVRIVSEAIQRSRAGLADPNRPIASFIFLGPTGVGKTELAKALASFLFDDE 633
gi 103487872 548 PVDRMMEGEREKLLKMEETLTQRVIGQDEAVRAVSTAVRRARAGLQDPNRPLGSFLFLGPTGVGKTELTKALARFLFDDD 627
gi 113953637 553 PVAKLVQSEMEKLLKLEDQLHQRVVGQNQAVTAVADAIQRSRAGLSDPNQPIASFLFLGPTGVGKTELSKALAAQLFDSE 632
gi 163848669 549 PVTKLLEGELEKLVHMEERLHQRVVGQDEAVIAVSNAVRRARAGLQDPNRPLGSFLFLGPTGVGKTELARALAEFLFDDE 628
gi 94971790  552 PVSKMLEGEVKKLVEMEDRLSQRVIGQDAAIEHVANAIRRSRAGLSDPKRPIGSFIFLGPTGVGKTELARALAAFLFDDE 631
gi 46580283  552 PVTRLLESEREKLLRLADVLHERVVGQEEAVDAVSEAVLRARAGLSDPSRPIGSFIFLGPTGVGKTELCKTLAEALFDTE 631
gi 42524440  549 PVSKMLESESQKLLHMEDSLKHRVVGQDHALTIVADAIRRARAEISDPNRPIGTFMFLGPTGVGKTETVKALAEFLFDDE 628
gi 19705246  555 PVSKLTETKKEKMLHLEDHIKERVKGQDEAIKSVADTMLRSVAGLKDPNRPMGSFIFLGPTGVGKTYLAKTLAYNLFDSE 634
gi 29350005  545 PVSKMMQSEKDKLLHLEDELHQRVIGQDEAIEAVADAVRRSRAGLQDPKRPIGSFIFLGTTGVGKTELAKALAEFLFDDE 624
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77917974  635 DNMVRIDMSEYMEKHTVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILFDEIEKAHHDVFNVLLQILDDGRVTDAQGRT 714
gi 37523146  634 NAMVRIDMSEYMEKHSVSRLIGAPPGYVGYDEGGQLTEAVRRRPYAVVLFDEIEKAHNDVFNVLLQVLDDGRITDSQGRT 713
gi 103487872 628 NAMVRIDMSEYMEKHSVARLVGAPPGYVGYEEGGTLTEAVRRRPYQVVLFDEVEKAHGDVFNILLQVLDDGRLTDGQGRT 707
gi 113953637 633 DALVRIDMSEYMEKHTVSRLIGAPPGYVGYEAGGQLTEAVRRRPYAVILFDEVEKAHPDVFNVMLQILDDGRVTDGQGRT 712
gi 163848669 629 QAMIRIDMSEYMEKHSVARLIGAPPGYVGYDEGGQLTEAVRRKPYSVVLFDEIEKAHPDVFNVLLQVLDDGRLTDGQGRI 708
gi 94971790  632 HAMVRIDMSEYGEKHSVSRLIGAPPGYVGYEEGGQLTEAIRRRLYAVLLFDEIEKAAPDVFNVFLQIMDDGQLTDGKGRR 711
gi 46580283  632 ENIVRLDMSEYMEKHAVARLIGAPPGYVGYDEGGQLTEAVRRKPYSVVLFDEVEKAHPDVFNTLLQILDDGRLTDSHGRT 711
gi 42524440  629 QAVVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTESVRRRPYSVVLLDEVEKAHPDVFNILLQVLDDGRLTDGQGRT 708
gi 19705246  635 DNVVRIDMSEYMDKFSVTRLIGAPPGYVGYEEGGQLTEAIRTKPYSVILFDEIEKAHPDVFNVLLQVLDDGRLTDGQGRI 714
gi 29350005  625 SMMTRIDMSEYQEKHSVSRLVGAPPGYVGYDEGGQLTEAIRRKPYSVVLFDEIEKAHPDVFNILLQVLDDGRLTDNKGRV 704
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77917974  715 IDFKNTVIILTSNIGSQHLLEGvsPE-------GEI--R--EEAGKAVMNELRHHFRPEFLNRVDDIVMFKPLSREEIKQ 783
gi 37523146  714 IDFKNAVIIMTSNIGSDAILRL--GG-------NDAy-Y--EQMREEVMRAMQVHFRPEFLNRVDDIIIFRNLRRDQLAA 781
gi 103487872 708 VDFTNTLIILTSNLGSQAIAAL--PD-------GAP--V--EQAEPAVMEVVRAHFRPEFLNRLDEIVLFHRLGQEHMGG 774
gi 113953637 713 VDFTNAVLILTSNIGSQSILDL--GG-------DDSq-H--QEMESRVNEALRNHFRPEFLNRIDDTIIFHSLRRDELRL 780
gi 163848669 709 VNFKNTVIIMTSNIASTTIQEL--TRa------GAG--Q--SEIRAAVMEELRGVLRPEFLNRIDEVIVFSPLSREHIDR 776
gi 94971790  712 VDFKNTIIIMTSNIGASFMTGD--AI-------QSQenY--ERASRLVMDALRQQFKPEFLNRVDDIVLFNPLGKEQLAK 780
gi 46580283  712 VDFRNTIIIMTSNIGSPYMLDG--IS-------EGG--EflSGVREKVMEELRRHFRPEFLNRVDETVLFKPLLPAQIAR 780
gi 42524440  709 VDFKNTVLIMTSNVGSQSILD---PG-------MSE-----NQKREAVNEALRERFRPEFLNRIDEIVMFKSLGEAQISG 773
gi 19705246  715 VDFKNTLIIMTSNIGSHFILED--PN-------LS------EDTREKVADELKARFKPEFLNRIDEIITFKALDLPAIKE 779
gi 29350005  705 VNFKNTIIIMTSNMGSSYIQSQ--MEklsgsnkEEV--I--EETKKEVMNMLKKNIRPEFLNRIDETIMFLPLTETEIRQ 778
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77917974  784 IIHLLAADLRKRLADRRIELELTEAACDFIAGEAYDPVFGARPLKRYLQHHLETRIGRALIGGDIHEGATIAVDVQD-GE 862
gi 37523146  782 IVKLQIARLEKRLADRKITLKLSEAAIDYIVEAGYDPVYGARPLKRAIQNELVNPLARGLLKGDFNDGDTIFVDIEN-ER 860
gi 103487872 775 IVDIQVARVQKLLDDRKVTLDLTDAARAWLGRVGYDPVYGARPLKRAVQKYLQDPLADLILKGEVRDGATIRVDEGD-GG 853
gi 113953637 781 IVALQVERLRKRLSERKLDLHISEEATDWLANAGYDPVYGARPLKRAIQRELETPIAKAILSGAYEEGSSVQIQVKE-ER 859
gi 163848669 777 IVEIQLNRLRKLLADRKLNLVLTDAARAQLAAEGYDPVYGARPLKRVIQQRIQNPLALQLLQGAFPEGSTIVVDVEN-GT 855
gi 94971790  781 IVELQLEYVRRLLADRRISLELSDAAKDVIFAQGYDPAYGARPLKRAIQKLVQDPLALKILDGEVLHGDHVVVGVSGeGK 860
gi 46580283  781 IVELLLGRLRGRLAERKIDIRLGDVARDFIAKAAYDPVYGARPLRRYLQHNIETPLARKLIAGELRDGTTVEVDVVD-DA 859
gi 42524440  774 IVKVQLDLVAQRLRAKKIGIDFNQEAIDFLAKKGYDPIYGARPLKRVIQTELLNPLSKEIISGKVKAGDTIHVKANG-ST 852
gi 19705246  780 IVKLSLKDLENKLKPKHITLEFSDKMVDYLANNAYDPHYGARPLRRYIQREIETSLAKKILANEVHEKSNVLIDLDN-NH 858
gi 29350005  779 IVLLQIKGVQKMLAENGVELEMTDAALNFLSQVGYDPEFGARPVKRAIQRYLLNDLSKKLLSQEVDRSKAIIVDSNG-DG 857

                 ..
gi 77917974  863 LV 864
gi 37523146  861 PV 862
gi 103487872 854 LM 855
gi 113953637 860 LN 861
gi 163848669 856 FV 857
gi 94971790  861 LT 862
gi 46580283  860 LS 861
gi 42524440  853 LT 854
gi 19705246  859 IV 860
gi 29350005  858 LV 859
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap